SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000002999 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000002999
Domain Number 1 Region: 25-118
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.62e-40
Family SWIB/MDM2 domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 282-326
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.08e-17
Family Ran binding protein zinc finger-like 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000002999
Domain Number - Region: 426-468
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0889
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000002999   Gene: ENSTRUG00000001298   Transcript: ENSTRUT00000003017
Sequence length 481
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:33296:36842:-1 gene:ENSTRUG00000001298 transcript:ENSTRUT00000003017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSSSSSCRTLPGDGSQQFRQYPTINIDIIVQPKAPLLQILRVAGAQEEVFTLKEVMHYL
GQYIMGKQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGCAGNAD
AAENLSVGRECVESGVEDRGQEKQRPQPCLLHYTQPKETPSQRRPREPDEGKRSVLNSTF
QVKCLMAGFNSSTSLQTLLKACHDQPANDLSPAQEEDTAIVSDTTDDLWFLTEGESEQVS
VEMKEAALEEGRGGEGEACSEEDDRAVFKMQEEPDEDSQCLSDDTDIEISTQDAWQCTEC
RKYNTPLQRYCVRCWALRKNWYKDVPRLAHSLSVPDIPACSSLTAQDDEDDSDAGIDVPD
CTRTVSDPVILPSHSTADRPLPPALSGKGKAPWSSSFHKDEPLSEGDSQESLGMEVEEVR
PEALLEPCKLCRVRPRNGNIIHGRTAHLLTCFPCARRLHKFHAPCPGCGKIIQNVIKIFI
L
Download sequence
Identical sequences H2RS83
ENSTRUP00000002999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]