SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003000 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003000
Domain Number 1 Region: 19-110
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.01e-40
Family SWIB/MDM2 domain 0.0000712
Further Details:      
 
Domain Number 2 Region: 229-273
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 9.22e-18
Family Ran binding protein zinc finger-like 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000003000
Domain Number - Region: 373-415
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0753
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003000   Gene: ENSTRUG00000001298   Transcript: ENSTRUT00000003018
Sequence length 428
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:33296:36824:-1 gene:ENSTRUG00000001298 transcript:ENSTRUT00000003018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCRTLPGDGSQQFRQYPTINIDIIVQPKAPLLQILRVAGAQEEVFTLKEVMHYLGQYIMG
KQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGCAAPSVVWSGGV
LIHQRHPVDGEAESFSLSVRGNLRSNYSCKSNGSTDIHTNQEEDTAIVSDTTDDLWFLTE
GESEQVSVEMKEAALEEGRGGEGEACSEEDDRAVFKMQEEPDEDSQCLSDDTDIEISTQD
AWQCTECRKYNTPLQRYCVRCWALRKNWYKDVPRLAHSLSVPDIPACSSLTAQDDEDDSD
AGIDVPDCTRTVSDPVILPSHSTADRPLPPALSGKGKAPWSSSFHKDEPLSEGDSQESLG
MEVEEVRPEALLEPCKLCRVRPRNGNIIHGRTAHLLTCFPCARRLHKFHAPCPGCGKIIQ
NVIKIFIL
Download sequence
Identical sequences H2RS84
ENSTRUP00000003000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]