SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003002 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003002
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.83e-39
Family SWIB/MDM2 domain 0.0000738
Further Details:      
 
Domain Number 2 Region: 263-307
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 1.02e-17
Family Ran binding protein zinc finger-like 0.0004
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000003002
Domain Number - Region: 407-449
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0837
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003002   Gene: ENSTRUG00000001298   Transcript: ENSTRUT00000003020
Sequence length 462
Comment pep:known_by_projection scaffold:FUGU4:scaffold_169:33296:36680:-1 gene:ENSTRUG00000001298 transcript:ENSTRUT00000003020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQPKAPLLQILRVAGAQEEVFTLKEVMHYLGQYIMGKQLYDKQRQHIVHCQDDPLGELLE
VESFSVKNPSPVYEMLKKYLVVLGCAGNADAAENLSVGRECVESGVEDRGLISLALCSPS
SSTYLTCITTPSQRRPREPDEDSLEGLPRSACKRPKLDVSLDEWDLSGLPWWFLGNLRSN
YSCKSNGSTDIHTNQEEDTAIVSDTTDDLWFLTEGESEQVSVEMKEAALEEGRGGEGEAC
SEEDDRAVFKMQEEPDEDSQCLSDDTDIEISTQDAWQCTECRKYNTPLQRYCVRCWALRK
NWYKDVPRLAHSLSVPDIPACSSLTAQDDEDDSDAGIDVPDCTRTVSDPVILPSHSTADR
PLPPALSGKGKAPWSSSFHKDEPLSEGDSQESLGMEVEEVRPEALLEPCKLCRVRPRNGN
IIHGRTAHLLTCFPCARRLHKFHAPCPGCGKIIQNVIKIFIL
Download sequence
Identical sequences H2RS86
ENSTRUP00000003002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]