SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003351 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003351
Domain Number 1 Region: 1-43
Classification Level Classification E-value
Superfamily Virus ectodomain 0.00000000000000117
Family Virus ectodomain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003351   Gene: ENSTRUG00000001457   Transcript: ENSTRUT00000003370
Sequence length 125
Comment pep:novel scaffold:FUGU4:scaffold_5304:5436:5813:-1 gene:ENSTRUG00000001457 transcript:ENSTRUT00000003370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQNRIAVDMLLAEKGGVCAVFGDQCCTFIPNNTASDGSLTLAIEGLRTLNSKMKEHSG
AKTAMWNEWMNVFGKYKTLVTSILISVAVFAAILTLCGCCCVPCLRSLINRLITTAIAPM
EKPYG
Download sequence
Identical sequences H2RT84
31033.ENSTRUP00000003351 ENSTRUP00000003351 ENSTRUP00000003351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]