SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000003968 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000003968
Domain Number 1 Region: 25-164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.56e-34
Family PAPS sulfotransferase 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000003968   Gene: ENSTRUG00000001737   Transcript: ENSTRUT00000003988
Sequence length 168
Comment pep:novel scaffold:FUGU4:scaffold_201:153991:155394:1 gene:ENSTRUG00000001737 transcript:ENSTRUT00000003988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVHNTSDLHQYKMSFFSAHMDSLDMITSDLFRYKGMNFPVKEKLRPKDIDALKDFEIHP
TDVFIITFPKSGTVWMQQILSQIMEASHPGWAEDVTNRAQIPYLEGRTVDDPFRDRKEPR
VVRTHLFPELLPHGVKEKQIKVVYVLRNPKDVLVSLYHFAHSWVLMDS
Download sequence
Identical sequences H2RV00
ENSTRUP00000003968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]