SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004348 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004348
Domain Number 1 Region: 28-142
Classification Level Classification E-value
Superfamily Immunoglobulin 8.57e-22
Family V set domains (antibody variable domain-like) 0.0027
Further Details:      
 
Domain Number 2 Region: 148-240
Classification Level Classification E-value
Superfamily Immunoglobulin 5.94e-20
Family C1 set domains (antibody constant domain-like) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004348   Gene: ENSTRUG00000001891   Transcript: ENSTRUT00000004372
Sequence length 251
Comment pep:known_by_projection scaffold:FUGU4:scaffold_388:4750:10432:1 gene:ENSTRUG00000001891 transcript:ENSTRUT00000004372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKEAAVLWWLVVLLCAAAGLVAGSDVTQPEQLWRPQGDNVIINCKHTKGSTYYQMYWYR
QLRGEHMKLIVFTAVGADHDFGNSDKRKFSATKPNAESGTFTVKNLEAADEGLIFCAVRT
PPNKSNKQEAYFGSGTKLTVLEPGLSVTGPTVTLLPPSSRECRNQKHQKRKKTIVCVASG
FYPDHVSVSWEVNGQKVTDGVATDGAALRPEGRFYRISSRLRVSAEDWFRPDSDFTCIIS
FFNGTSTELYS
Download sequence
Identical sequences H2RW28
ENSTRUP00000004348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]