SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000004854 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000004854
Domain Number 1 Region: 83-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.76e-45
Family RecA protein-like (ATPase-domain) 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000004854
Domain Number - Region: 5-57
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00518
Family DNA repair protein Rad51, N-terminal domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000004854   Gene: ENSTRUG00000002107   Transcript: ENSTRUT00000004883
Sequence length 335
Comment pep:known_by_projection scaffold:FUGU4:scaffold_3087:3461:4749:-1 gene:ENSTRUG00000002107 transcript:ENSTRUT00000004883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPVSSLSLNPGVKVKLVSAGFQFTTDLLHVKPQQLSKEAALNQQEALEVLQAVRRADE
GAASSSSTALELLQKEEEELRSIVTFSSQLDAALGGGAPVGRVTEVCGVPGVGKTQLCLQ
LAVDAQVPRCFGGVGGQVVYIDTEGSFLIQRVADLAAAAVNHCSLLVEDQEQRVAMETFT
VESILSNMFVVRCHDYIELLAELHLMPGFLSDHPRVRLLVIDSVASPFRPLFDELLQRTR
LLSGFAQQLLSMATSHDIAVVITNQMTTRVQGAQSQLVPALGDSWGHAATIRLLLQWEGP
QRLAIIVKSPCHRVSTVRYTITSEGFRDAEQWSEP
Download sequence
Identical sequences H2RXI4
ENSTRUP00000004854 ENSTRUP00000004854 31033.ENSTRUP00000004854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]