SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005695 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005695
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 197-318
Classification Level Classification E-value
Superfamily Kelch motif 3.14e-20
Family Kelch motif 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000005695
Domain Number - Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000617
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 162-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family EGF-type module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005695   Gene: ENSTRUG00000002464   Transcript: ENSTRUT00000005730
Sequence length 367
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2668:635:7635:-1 gene:ENSTRUG00000002464 transcript:ENSTRUT00000005730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLTGPSGHLTDGPGNYKYKTKCTWLIEGQPNSILRLRFNHFATECSWDHLYVYDGDSIY
APLLAAFSGLIIPERYGNETVPEVVSQSGYALLHFFSDAAYNLTGFNISYRLNMCPNNCS
ARGQCQVGNSTGSVHCECERGWKGPACDVPHCLAEADCGFPERGRCRDKTCVCESGWQGP
DCSVSVPANSSFWTREETREEYADAGLARASHKAVVDQDVMWVIGGYVFNSSDYHMVKAF
NLSSRSWLTLSPSATVTPRYGHSLALHEGKIYMYGGKIDSTGNVSSQLWVFHIQNQTWVL
LSPQITQDQYAVVGHSAHIVPPVQEGSSPTMLVLFGHCPLYGYISQVQEYNIGKTWSSPV
CLQCILL
Download sequence
Identical sequences H2RZX4
31033.ENSTRUP00000005695 ENSTRUP00000005695 ENSTRUP00000005695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]