SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006866 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006866
Domain Number 1 Region: 17-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.93e-19
Family V set domains (antibody variable domain-like) 0.011
Further Details:      
 
Domain Number 2 Region: 131-231
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-16
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006866   Gene: ENSTRUG00000002942   Transcript: ENSTRUT00000006911
Sequence length 322
Comment pep:novel scaffold:FUGU4:scaffold_2351:11827:13556:1 gene:ENSTRUG00000002942 transcript:ENSTRUT00000006911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLTDETSSFVYPVNSLLFANVGENVTLQCSCKDKSVSRLQWYKQTQGEKPKPISMFKDH
DKNVVLGKEFQIPDRFSVNITEGVSHLKIVNLRISDSGTYYCTSSLMYEFKFEKIYLVHV
KSSVLNIPVEVHQSPSGSFQSGGSVTLNCRVHTGICDKEHTVYWFWNSGDSAPELIYTHG
GKKEQCERRTNTCFYNLSMKNQNISDAGIYYCVVESCGRILFGDPTKLEIGQSKPNKDHL
VYYLTGALVFTTMLCVLLAIPMLKQCGRISSHRTGKYPSDESSVINFPHQVQEGNLHYAT
LKKKKRNKSSNENECIYSSVVQ
Download sequence
Identical sequences H2S394
ENSTRUP00000006866 ENSTRUP00000006866 31033.ENSTRUP00000006866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]