SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006966 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006966
Domain Number 1 Region: 124-221
Classification Level Classification E-value
Superfamily Immunoglobulin 8.41e-16
Family V set domains (antibody variable domain-like) 0.033
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000304
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006966   Gene: ENSTRUG00000002981   Transcript: ENSTRUT00000007011
Sequence length 270
Comment pep:novel scaffold:FUGU4:scaffold_2287:11915:14836:1 gene:ENSTRUG00000002981 transcript:ENSTRUT00000007011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TATREFSPSLIWKTNFILVKPGENLTLPCLHRDDVSTKISLFEQILGERPRLICTYWISS
KLWIFVNDFKTNPHFYNKGTNLTITDLKLSDSATYYCVNQYLNVFDFTEGHNVIVEGSGL
TIDQSASHSIQAEGSVTLNCTVHTGWTCDGDHTVYWFRNSGQSQLGLMYSHTGRNKQCER
KTNTCFHSISMKNLNTSQTGTYYCAVAACGHILFGNGTKLVFEDDKYSQFSVYFLCGASS
FSTFLVEYLAFSVCMMNSHSCNYKENSQNR
Download sequence
Identical sequences H2S3J4
ENSTRUP00000006966 31033.ENSTRUP00000006966 ENSTRUP00000006966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]