SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007622 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007622
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-39
Family Spermadhesin, CUB domain 0.00014
Further Details:      
 
Domain Number 2 Region: 237-349
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-38
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 3 Region: 125-231
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 361-455
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-26
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 5 Region: 461-502
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000393
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007622   Gene: ENSTRUG00000003253   Transcript: ENSTRUT00000007669
Sequence length 503
Comment pep:known_by_projection scaffold:FUGU4:scaffold_547:85662:95504:1 gene:ENSTRUG00000003253 transcript:ENSTRUT00000007669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCGDTLTSPSGTITSPGHPSIYPHGANCTWYITVSPGNLVQLVFESFNLEYHTNCNFDYV
EVYDNGTVQTGSKLGRYCGRSVPPSITSTDNQLTLLFVSDTSLATEGFSASYVSIDAATD
CSETFTSPTGSFSSPNYPNYYPNNRDCIFKIIVEVNMQIMLNFSSFSLEGSTPSCYFDFV
EIRDGGYETSPLIGKFCGSDRPPAIVSHSNRLWVKFHSDSAITYGGFTAHWDGTQTGCGG
TLTTASGGFSSPNYPLPYHPNAECYWTIRTSQGNQLLLSFSDFHLESSASCSYDYLAVYD
GSSDSAPQLGRLCGSQQPSTINSTGNQLYIKLRTDSSVAAGGFLASYSTECSNVLVSGRY
RGVVESLNFPRNYPASAQCSWTIQATTGNTINYTFTAFQLEGPASSCVYDYLTCFSFGLG
RYCGDELPHPVTSFSNSLLVNFVSDLSISDRGFRVAVFNPGCGGDLVMENGAFNSPNYPD
PYPPNVECVWTIRSSPGNRLQLS
Download sequence
Identical sequences H2S5F0
ENSTRUP00000007622 31033.ENSTRUP00000007622 ENSTRUP00000007622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]