SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007686 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007686
Domain Number 1 Region: 81-160
Classification Level Classification E-value
Superfamily Virus ectodomain 1.95e-19
Family Virus ectodomain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007686   Gene: ENSTRUG00000003290   Transcript: ENSTRUT00000007733
Sequence length 270
Comment pep:novel scaffold:FUGU4:scaffold_2419:179:1061:-1 gene:ENSTRUG00000003290 transcript:ENSTRUT00000007733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WWLCGHNAYADLPANWPGVCAPVHLNDHTVIIYAANARSAPQLRSRRDLNDYEFKPHDSV
WGTDVPKEFKHWTDGEKVSISLFPWVGVAKNILRLETVDYRLKVFTNLTKVALTGVKEEM
TALRLMTMQNRMALDLITAPQGGVCAMVGDYCCTFIPENDADGHFSALKNLTKLQKAMID
DGSPPPDWLTGMLSRWRELLFKIGMMIGIVLLVLAILACCVVPLVRGCIGRLVGSAVTST
LLQVEEQFLLDNDEEESEKEWTNVMHDEND
Download sequence
Identical sequences H2S5L4
ENSTRUP00000007686 31033.ENSTRUP00000007686 ENSTRUP00000007686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]