SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007883 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007883
Domain Number 1 Region: 150-377,420-469
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-49
Family Glycerol-3-phosphate transporter 0.073
Further Details:      
 
Domain Number 2 Region: 589-734
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.96e-19
Family Glycerol-3-phosphate transporter 0.066
Further Details:      
 
Domain Number 3 Region: 493-575
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000017
Family Pentapeptide repeats 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007883   Gene: ENSTRUG00000003368   Transcript: ENSTRUT00000007930
Sequence length 737
Comment pep:known_by_projection scaffold:FUGU4:scaffold_170:22462:33410:1 gene:ENSTRUG00000003368 transcript:ENSTRUT00000007930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDDGRYRDGRSDFIRGAKDIAKVAKKQVGKKVGRGVDKMADEYTRRSYKRFEEEDDDDD
YSGVPGNDDGYYRNDSRANDDEGHSDSTEGHDEDDEIYEGEYQGIPRADSGKAPGMDGVM
TAEAQQFRDLSAYEGERRKDQEELAQQYESILQECGHGKFQWTLYFVLGLALMADGVEIF
VVGFVLPFAEKDMCLSEPNKGMLGLIVYLGMMVGAFVWGGLADRIGRRQTLLIALSINSV
FAFFSSFVQGYISFLFCRLTSGVGIGGSIPIVFSYYSEFLAQEKRGEHLSWLCMFWMLGG
IYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPAVAAICALTTMPESPRFFLEN
GKHDEAWMILKQVHDTNMRAKGYPERVFSVTTIKTVKQMEDLVNLGDGAAWHEKWRIKLT
TLFHQVWSNFQAVFSPEYRRTTYMMMAVWFSMSFSYYGLTVWFPDMIKYLQKQEYSSRTK
VFIKEKVEHVTFNFTLENQVHRQGEYFNDKFMNLKMRSMVFEDSLFEECFFEDITSSNTF
FKNCTFIATLFYNTDLFKYRLVNCRLINSTFLHNKEGCMLSDVSDENNAYMVYFVSFLGT
LAVLPGNIVSALLMDKIGRLRMLAGSSVISCISCFFLSFGNSESAMIALLCLFGGISIAS
WNSLDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAVPILFASGALAA
GSFLALKLPETRGQVLK
Download sequence
Identical sequences H2S661
XP_003965731.1.43653 31033.ENSTRUP00000007883 ENSTRUP00000007883 ENSTRUP00000007883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]