SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008229 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008229
Domain Number 1 Region: 147-389
Classification Level Classification E-value
Superfamily vWA-like 7.34e-85
Family Integrin A (or I) domain 0.000000253
Further Details:      
 
Domain Number 2 Region: 369-478
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-20
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 648-732
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000418
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 4 Region: 35-93
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 606-647
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 564-602
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008229   Gene: ENSTRUG00000003505   Transcript: ENSTRUT00000008277
Sequence length 804
Comment pep:known_by_projection scaffold:FUGU4:scaffold_329:89400:95567:1 gene:ENSTRUG00000003505 transcript:ENSTRUT00000008277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMCRRASEDQMDLRLLLIAALSAVLSISWAQQEGSVCIKANAQSCGECIQVSESCGWCTD
VSFLSEGESKSARCDDLESLKKRKCTAESIENPRGSVVVDKDKPVTNRRNEPGKLKPEQI
TQIQPQKLTLTLRSGEPQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMK
EMQKITSDFRIGFGSFVEKTVMPYISTTPARLANPCTGNQNCTSPFSYKNVLKLTNKGDE
FNRLVSQQQISGNLDSPEGGFDAIMQVAVCQNEIGWRNVTRLLVFSTDAGFHFAGDGKLG
GIVLPNDGKCHLEKDMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNL
IPKSAVGTLSSNSSNVIKLIIDAYNSLSSEVILENGKLPEGVSINYKSICKNGVEGTGEN
GRKCSNISIGDEVFFQISVQADKCPADSRSETIRIKPLGFTEEVEIVVNFICDCECAAKG
EPQSSKCDNGNGIFQCGACKCNEGRIGRVCECSKDDVHTEDLDANCRKDNGTDICSNNGD
CVCGTCECKKRQNPAEIYSGKYCECDNFNCDRSNNMLCGGHGRCECRKCICDANYTGSAC
DCSMDKSTCMAKNGQLCNGRGLCECGICKCTDVKFQGPTCEICPTCPGVCQEHKDCVLCR
AFPSEKPCVNCSYFDLVKVADRDKLPQPTDQSFPLTHCKVRDENDCWVYYTFAIQNQTRL
VHVVEKPGCTEGPDIVPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAK
WDTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2S757
ENSTRUP00000008229 ENSTRUP00000008229 31033.ENSTRUP00000008229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]