SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008232 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008232
Domain Number 1 Region: 134-376
Classification Level Classification E-value
Superfamily vWA-like 7.19e-85
Family Integrin A (or I) domain 0.000000253
Further Details:      
 
Domain Number 2 Region: 356-465
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-20
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 637-721
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000418
Family Integrin beta tail domain 0.0028
Further Details:      
 
Domain Number 4 Region: 22-80
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 551-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family Integrin beta EGF-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008232   Gene: ENSTRUG00000003505   Transcript: ENSTRUT00000008280
Sequence length 793
Comment pep:known_by_projection scaffold:FUGU4:scaffold_329:89795:95567:1 gene:ENSTRUG00000003505 transcript:ENSTRUT00000008280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVPPILLSLIGLLPLLACWEGSVCIKANAQSCGECIQVSESCGWCTDVSFLSEGESKSAR
CDDLESLKKRKCTAESIENPRGSVVVDKDKPVTNRRNEPGKLKPEQITQIQPQKLTLTLR
SGEPQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMKEMQKITSDFRIGF
GSFVEKTVMPYISTTPARLANPCTGNQNCTSPFSYKNVLKLTNKGDEFNRLVSQQQISGN
LDSPEGGFDAIMQVAVCQNEIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLE
KDMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSSNS
SNVIKLIIDAYNSLSSEVILENGKLPEGVSINYKSICKNGVEGTGENGRKCSNISIGDEV
FFQISVQADKCPADSRSETIRIKPLGFTEEVEIVVNFICDCECAAKGEPQSSKCDNGNGI
FQCGACKCNEGRIGRVCECSKDDVHTEDLDANCRKDNGTDICSNNGDCVCGTCECKKRQN
PAEIYSGKYCECDNFNCDRSNNMLCGVPGHGRCECRKCICDANYTGSACDCSMDKSTCMA
KNGQLCNGRGLCECGICKCTDVKFQGPTCEICPTCPGVCQEHKDCVLCRAFPSEKPCVNC
SYFDLVKVADRDKLPQPTDQSFPLTHCKVRDENDCWVYYTFAIQNQTRLVHVVEKPGCTE
GPDIVPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKS
AVTTVVNPKYEGK
Download sequence
Identical sequences H2S760
ENSTRUP00000008232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]