SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008235 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008235
Domain Number 1 Region: 138-380
Classification Level Classification E-value
Superfamily vWA-like 6.97e-85
Family Integrin A (or I) domain 0.000000253
Further Details:      
 
Domain Number 2 Region: 360-469
Classification Level Classification E-value
Superfamily Integrin domains 1.78e-20
Family Integrin domains 0.001
Further Details:      
 
Domain Number 3 Region: 26-84
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000126
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 639-710
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000157
Family Integrin beta tail domain 0.0027
Further Details:      
 
Domain Number 5 Region: 597-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Integrin beta EGF-like domains 0.0031
Further Details:      
 
Domain Number 6 Region: 555-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008235   Gene: ENSTRUG00000003505   Transcript: ENSTRUT00000008283
Sequence length 782
Comment pep:known_by_projection scaffold:FUGU4:scaffold_329:90154:95567:1 gene:ENSTRUG00000003505 transcript:ENSTRUT00000008283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMDLRLLLIAALSAVLSISWAQQEGSVCIKANAQSCGECIQVSESCGWCTDVSFLSEGES
KSARCDDLESLKKRKCTAESIENPRGSVVVDKDKPVTNRRNEPGKLKPEQITQIQPQKLT
LTLRSGEPQTFKLKFKRAEDYPIDLYYLMDLSFSMKDDLENVKNLGTDLMKEMQKITSDF
RIGFGSFVEKTVMPYISTTPARLANPCTGNQNCTSPFSYKNVLKLTNKGDEFNRLVSQQQ
ISGNLDSPEGGFDAIMQVAVCQNEIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGK
CHLEKDMYTMSHYYDYPSIAHLVQKLSDHNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SSNSSNVIKLIIDAYNSLSSEVILENGKLPEGVSINYKSICKNGVEGTGENGRKCSNISI
GDEVFFQISVQADKCPADSRSETIRIKPLGFTEEVEIVVNFICDCECAAKGEPQSSKCDN
GNGIFQCGACKCNEGRIGRVCECSKDDVHTEDLDANCRKDNGTDICSNNGDCVCGTCECK
KRQNPAEIYSGKYCECDNFNCDRSNNMLCGGHGRCECRKCICDANYTGSACDCSMDKSTC
MAKNGQLCNGRGLCECGICKCTDVKFQGPTCEICPTCPGVCQEHKDCVLCRAFPSEKPCV
NCSYFDLDQSFPLTHCKVRDENDCWVYYTFAIQNQTRLVHVVEKPGCTEGPDIVPIVAGV
VAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYE
GK
Download sequence
Identical sequences H2S763
ENSTRUP00000008235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]