SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008683 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008683
Domain Number 1 Region: 56-514
Classification Level Classification E-value
Superfamily Sema domain 2.62e-142
Family Sema domain 0.000000183
Further Details:      
 
Domain Number 2 Region: 510-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000192
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008683   Gene: ENSTRUG00000003699   Transcript: ENSTRUT00000008734
Sequence length 790
Comment pep:known_by_projection scaffold:FUGU4:scaffold_533:50501:57793:-1 gene:ENSTRUG00000003699 transcript:ENSTRUT00000008734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLCVREGWCLSSTTASTLFPKDLEPTSVVDSEQSRLFPSFQGLLQDNNTLRLGLDFQRM
IRINHMLYIAARDHVFAVNLTTASEQFVPQLKLTWRSKDVNKCLVRGKNSDECYNYIKVL
VPRDDETLFACGTNAFNPTCRNYKMVSLEQVGEELVGQARCPFESGQSNVGLFAGGDFYS
ATMTDFLASDAVIYRSLGDGRPVLRTVKYDSKWLREPHFLHAIDYGNYVYFFLSEMAVEY
TALGKVVFSRVARVCKNDNGGSPRVLDRYWTSFLKARLNCSVPGDSFFYFDVLQSLTNVL
QINQRPAVVGVFTTQANSIPGSAVCAFYMDDIEKVFNRKFKEQRANDLSWTPVAEELVPQ
PRPGTCAGDGAAAEYKSSVQFPDEMLTFIKTYPLMDEAVPSVNERPCFTRTSSRSKLTQI
VVDVSAGLTKDRTVMFLGSEDGRILKVLASTHPNNSVGTELLEDIDVYNPSKCDVQGQED
RRVLGLELDKDHHALFVAFSSCVIRVPLSRCGHHGTCRRACLTSTDPYCVWLRTGRCGNR
PPGFRAEFEQEVEGDHVLNADSCDALPFFPDCVISAIAEARGKQPHNSNKAATSRPLMSQ
TWRPRRCVNITVTLKPRPHYQYINTWWRLDPLQRWNLDQRVAAHVHYTLLIACVLVAFSL
GAILSGFLVSCYCSRSAAQRACRLGKDPEASLSHALSLRSLAKISGLLDTQSKEDKLDVS
SPKLYSSFIPNGLSEPRACSNGLRGLVLADGELDRPQADGELSGLPTPDSTPKMSGRKTQ
QHRQYERNQN
Download sequence
Identical sequences H2S8F8
ENSTRUP00000008683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]