SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008685 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008685
Domain Number 1 Region: 65-526
Classification Level Classification E-value
Superfamily Sema domain 4.19e-142
Family Sema domain 0.000000189
Further Details:      
 
Domain Number 2 Region: 522-557
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000015
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008685   Gene: ENSTRUG00000003699   Transcript: ENSTRUT00000008736
Sequence length 640
Comment pep:known_by_projection scaffold:FUGU4:scaffold_533:50958:57579:-1 gene:ENSTRUG00000003699 transcript:ENSTRUT00000008736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHRLLPWQPARLWLFLGWCLSSTTASTLFPKDLEPTSVVDSEQSRLFPSFQGLLQDNNTL
RLGLDFQRMIRINHMLYIAARDHVFAVNLTTASEQFVPQLKLTWRSKDVNKCLVRGKNSD
ECYNYIKVLVPRDDETLFACGTNAFNPTCRNYKMVSLEQVGEELVGQARCPFESGQSNVG
LFAGGDFYSATMTDFLASDAVIYRSLGDGRPVLRTVKYDSKWLREPHFLHAIDYGNYVYF
FLSEMAVEYTALGKVVFSRVARVCKNDNGGSPRVLDRYWTSFLKARLNCSVPGDSFFYFD
VLQSLTNVLQINQRPAVVGVFTTQANSIPGSAVCAFYMDDIEKVFNRKFKEQRANDLSWT
PVAEELVPQPRPGTCAGDGAAAEYKSSVQFPDEMLTFIKTYPLMDEAVPSVNERPCFTRT
SSRSKLTQIVVDVSAGLTKDRTVMFLGSEDGRILKVLASTHPNNSVGTELLEDIDVYNPS
NACRCDVQGQEDRRVLGLELDKDHHALFVAFSSCVIRVPLSRCGHHGTCRRACLTSTDPY
CVWLRTGRCGNRPPGFRAEFEQEVEGDHVLNADSCEVGHFPDLDQRVAAHVHYTLLIACV
LVAFSLGAILSGFLVSCYCSRSAAQRACRLGKDPEASLSH
Download sequence
Identical sequences H2S8G0
ENSTRUP00000008685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]