SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008864 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008864
Domain Number 1 Region: 34-481
Classification Level Classification E-value
Superfamily Sema domain 3.79e-116
Family Sema domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 1328-1455,1666-1852
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 834-930
Classification Level Classification E-value
Superfamily E set domains 2.04e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 927-1018
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000255
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 484-535
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000296
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1017-1119
Classification Level Classification E-value
Superfamily E set domains 0.00000000148
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008864
Domain Number - Region: 1130-1192
Classification Level Classification E-value
Superfamily E set domains 0.00042
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008864   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008915
Sequence length 1882
Comment pep:known_by_projection scaffold:FUGU4:scaffold_301:103816:127307:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCVHLQVTVQDSLWTWLLYSSVVRGSSPLSLYPTFVQNNTQFEHLALHPDPSIGWIYVGA
QDHLFQLDRFLQPEYQTDTGPIIDSRECLPPVTESNCPQARITNNHNKLLLVDPYSMELI
TCGSVNQGICQKRSLDSVNNVFFSTERPVDTQYVAANHPNVSTVGLVVRPKPDRKPLMFV
GRGYTSSHPPISTRNLAQEPVFSYEETAKLAVAGRLSEYDHHFVSSFAHRQHVYFFFYRR
DLKSMSREYRTYVSRICLDDQAYYSYVEVPLTCRSMAGKVYNLLQAAQLGISKDGVVDSE
TLFGVFSTHSTSSFPPSEDSALCMFNLEDVDRRIISTRDLCYTQMGREAGVEVAYIEYEV
KSNCANLPENTLETYPCGSDHTPSPMASRVPVEAETILNSPSARLTAVAVSVRAAHTIAF
LGDSRGNLHKIQVFLGPNGEVEEYSVISVQKNAAISSDLILDQNEEHLFIMTPNMLQKRP
VAECQQHPDCQSCLLAHDPYCGWCVLDGRCVLQSQCSRGQRPGEWLWSFDMDQQCLQVQE
LNPSNLSREESQTVSLTYSISGCAWAPLLDEGESYSCIFEDVHSPAVVSRDRVSCQSPNP
GSLPVVPLGQGEQLLDSLSVSHHDISVTITVRDFTFYDCTVHSCRGCVRSRWGCNWCVQQ
HVCTHKPTCEDGTIIYNQHVTCPCLEKVQGSSLLPVGVERKITLLAQTYTCIRCPQDVEL
DYECVLVIEGHTVVVDAFVESDDMNPSSFDITCQLHKYSSVGNQYNAMVYVKRRNTFHLD
SSPDLFVTLYNCSVGRSDCSRCHTADQKYGCVWCGGAQASCLYSQSCSEPVQHTCPAPVI
HSIEPLSGLLEGGTMVTISGSNLGQKVEDILHSVSVAGVPCSVISSLYEISSRIVCRTTA
SGGKNSGQVSVKVSGGELGLSTEMFTFQDPFVMSVSPHRGPKAGGTILTIIGRNLLTGRP
SDLTVTVGRVSCHIMEPYSSSSLQCVTGSSNLTGQYRVTLHYSSGLRHLHSSTYRYTHNP
NITLAMPTKSFLRGGRLIYVSGHNLDVVQEPRMVVTSSSSQLMQQRERCDVNSSSLMLCR
SPSVDSSVMGSKMTVEFLLDNLRFNLSSLTPQGFTYEPNPDLRPLNQQDPMKAYRYNPGS
FIQLEGENLDLAITKDEVVVLIGQGVCAVKTLTRNHLYCEPPPKQPPPISNVQMGNLNFS
LGKVQYDTIGLSTFPLEAQIGVGVGASIVALIVLLPLNRRKSKQAMKDYKKVQIQLENLE
TSVRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFFPGHRESPLRRDLDVQE
CRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFT
DILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFLRDSAGESLYMLFRA
IKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLLNLFPWVLQTLNVLVQGAGVSEYQ
PLPTKVLDCDTITQVKEKLLDQVYKGTSFSHRPHSDSLDLEWRSGVAGHLILSDEDLTSV
VQGSWKRLNTLQHYKQVPEGATVALVARHTKHIHDNHDYMAGRALSTFTQPFAMPFFWRS
QTPMLEDADEGGVRPWHLVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLLSMKGTLQ
KFVDDLFTVILSTCRPVPLAVKYFFDLLDEQAGQHGISDSDTIHIWKTNSLPLRFWINII
KNPQFIFDVQASDHVDAVLSVISQTFMDSCTIAEHKLGRDSPINKLLYARDIPRYKQMVE
RYYSDIRQTVSASDQEMNSALAELSRNYSGELNYLVALHELYKYINKYYDQIITALEEDS
TAQKMQLGYRLQQIAAAVENKV
Download sequence
Identical sequences H2S8Y8
ENSTRUP00000008864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]