SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008865 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008865
Domain Number 1 Region: 28-473
Classification Level Classification E-value
Superfamily Sema domain 2.75e-118
Family Sema domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 1386-1513,1698-1884
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 842-936
Classification Level Classification E-value
Superfamily E set domains 4.08e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 935-1026
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000255
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 476-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1025-1069,1107-1161
Classification Level Classification E-value
Superfamily E set domains 0.000000154
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.081
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008865
Domain Number - Region: 1172-1230
Classification Level Classification E-value
Superfamily E set domains 0.00118
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 
Domain Number - Region: 634-675
Classification Level Classification E-value
Superfamily Plexin repeat 0.00249
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008865   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008916
Sequence length 1917
Comment pep:known_by_projection scaffold:FUGU4:scaffold_301:103869:127319:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFEWSLIALFILRVSVVRGSSPLSLYPTFVQNNTQFEHLALHPDPSIGWIYVGAQDHLFQ
LDRFLQPEYQTDTGPIIDSRECLPPVTESNCPQARITNNHNKLLLVDPYSMELITCGSVN
QGICQKRSLDSVNNVFFSTERPVDTQYVAANHPNVSTVGLVVRPKPDRKPLMFVGRGYTS
SHPPISTRNLAQEPVFSYEETAKLAVAGRLSEYDHHFVSSFAHRQHVYFFFYRRDLKSMS
REYRTYVSRICLDDQAYYSYVEVPLTCRSMAGKVYNLLQAAQLGISKDGVVDSETLFGVF
STHSTSSFPPSEDSALCMFNLEDVDRRIISTRDLCYTQMGREAGVEVAYIEYEVKSNCAN
LPENTLETYPCGSDHTPSPMASRVPVEAETILNSPSARLTAVAVSVRAAHTIAFLGDSRG
NLHKVFLGPNGEVEEYSVISVQKNAAISSDLILDQNEEHLFIMTPNMLQKRPVAECQQHP
DCQSCLLAHDPYCGWCVLDGRCVLQSQCSRGQRPGEWLWSFDMDQQCLQVQELNPSNLSR
EESQTVSLTYSISGCAWAPLLDEGESYSCIFEDVHSPAVVSRDRVSCQSPNPGSLPVVPL
GQDYITVSLSLRFGSVTITVRDFTFYDCTAVKQLSGRTPCRGCVRSRWGCNWCVQQHVCT
HKPTCEDGTIIYNQHGDEGSYVSWGSSACPCLEKVQGSSLLPVGVERKITLLAQTYTCIR
YNTQDVELDYECVLVIEGHTVVVDAFVESDDMNPSSFDITCQLHKYSSVGNQYNAMVYVK
RRNTFHLDSSPDLFVTLYNCSVGRSDCSRCHTADQKYGCVWCGGAQASCLYSQSCSEPVQ
HTCPAPVIHSIEPLSGLLEGGTMVTISGSNLGQKVEDILHSVSVAGVPCSVISSLYEISS
RIVCRTTASGGKNSGQVSVKVSGGELGLSTEMFTFQDPFVMSVSPHRGPKAGGTILTIIG
RNLLTGRPSDLTVTVGRVSCHIMEPYSSSSLQCVTGSSNLTGQYRVTLHYSSGLRHLHSS
TYRYTHNPNITLAMPTKSFLRGGRLIYVSGHNLDVVQEPRMVVTSSSSQLMQQRGKRMLP
DHPECPENLQCFVREVCGYVSSSLSQFSERCDVNSSSLMLCRSPSVDSSVMGSKMTVEFL
LDNLRFNLSSLTPQGFTYEPNPDLRPLNQQDPMKAYRYNPGSFIQLEGENLDLAITKDEV
VVLIGQGVCAVKTLTRNHLYCEPPPKQPPPISNGRKREGFDSLPEFTVQMGNLNFSLGKV
QYDTIGLSTFPLEAQIGVGVGASIVALIVPLQTFQIMRKSKQAMKDYKKVQIQLENLETS
VRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFFPGHRESPLRRDLDVQECR
RQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDI
LKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFLRDSAGESLYMLFRAIK
HQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNVLVQGAGVSEYQPLPTKVLDCDT
ITQVKEKLLDQVYKGTSFSHRPHSDSLDLEWRSGVAGHLILSDEDLTSVVQGSWKRLNTL
QHYKQVPEGATVALVARHTKHIHDNHDYMAGEKTPMLEDADEGGVRPWHLVKASEEPELP
KHRRGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVILSTCRPVPLAVKYFFDLL
DEQAGQHGISDSDTIHIWKTNSLPLRFWINIIKNPQFIFDVQASDHVDAVLSVISQTFMD
SCTIAEHKLGRDSPINKLLYARDIPRYKQMVERYYSDIRQTVSASDQEMNSALAELSRNY
SGELNYLVALHELYKYINKYYDQIITALEEDSTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2S8Y9
ENSTRUP00000008865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]