SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008867 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008867
Domain Number 1 Region: 28-466
Classification Level Classification E-value
Superfamily Sema domain 3.92e-117
Family Sema domain 0.0000637
Further Details:      
 
Domain Number 2 Region: 1306-1433,1641-1827
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 815-911
Classification Level Classification E-value
Superfamily E set domains 2.04e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 908-999
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000255
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 469-520
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000296
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 998-1097
Classification Level Classification E-value
Superfamily E set domains 0.00000000000902
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.032
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008867
Domain Number - Region: 1108-1170
Classification Level Classification E-value
Superfamily E set domains 0.000406
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008867   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008918
Sequence length 1857
Comment pep:known_by_projection scaffold:FUGU4:scaffold_301:104047:127307:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSILLLAISFSVSVVRGSSPLSLYPTFVQNNTQFEHLALHPDPSIGWIYVGAQDHLFQ
LDRFLQPEYQTDTGPIIDSRECLPPVTESNCPQARITNNHNKLLLVDPYSMELITCGSVN
QGICQKRSLDSVNNVFFSTERPVDTQYVAANHPNVSTVGLVVRPKPDRKPLMFVGRGYTS
SHPPISTRNLAQEPVFSYEETAKLAVAGRLSEYDHHFVSSFAHRQHVYFFFYRRDLKSMS
REYRTYVSRICLDDQAYYSYVEVPLTCRSMAGKVYNLLQAAQLGISKDGVVDSETLFGVF
STHSTSSFPPSEDSALCMFNLEDVDRRIISTRDLCYTQMGREAGVEVAYIECDSGENTLE
TYPCGSDHTPSPMASRVPVEAETILNSPSARLTAVAVSVRAAHTIAFLGDSRGNLHKVFL
GPNGEVEEYSVISVQKNAAISSDLILDQNEEHLFIMTPNMLQKRPVAECQQHPDCQSCLL
AHDPYCGWCVLDGRCVLQSQCSRGQRPGEWLWSFDMDQQCLQVQELNPSNLSREESQTVS
ISGCAWAPLLDEGESYSCIFEDVHSPAVVSRDRVSCQSPNPGSLPVVPLGQGEQLLDSLS
VSHHDISVTITVRDFTFYDCTVHSCRGCVRSRWGCNWCVQQHVCTHKPTCEDVNHRISIP
RACPCLEKVQGSSLLPVGVERKITLLAQTYTCIRCPQDVELDYECVLVIEGHTVVVDAFV
ESDDMNPSSFDITCQLHKYSSVGNQYNAMVYVKRRNTFHLDSSPDLFVTLYNCSVGRSDC
SRCHTADQKYGCVWCGGAQASCLYSQSCSEPVQHTCPAPVIHSIEPLSGLLEGGTMVTIS
GSNLGQKVEDILHSVSVAGVPCSVISSLYEISSRIVCRTTASGGKNSGQVSVKVSGGELG
LSTEMFTFQDPFVMSVSPHRGPKAGGTILTIIGRNLLTGRPSDLTVTVGRVSCHIMEPYS
SSSLQCVTGSSNLTGQYRVTLHYSSGLRHLHSSTYRYTHNPNITLAMPTKSFLRGGRLIY
VSGHNLDVVQEPRMVVTSSSSQFSERCDVNSSSLMLCRSPSVDSSVMGSKMTVEFLLDNL
RFNLSSLTPQGFTYEPNPDLRPLNQQDPMKAYRYNPGSFIQLEGENLDLAITKDEVVVLI
GQGVCAVKTLTRNHLYCEPPPKQPPPISNVQMGNLNFSLGKVQYDTIGLSTFPLEAQIGV
GVGASIVALIVLLPLNRRKSKQAMKDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMS
SDLVGSGIPFLDYRMYAERIFFPGHRESPLRRDLDVQECRRQTVEQGLVQLSNLLNSKLF
LTKFIHTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLM
LRRTETVVEKLLTNWMSICLYAFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLN
DNRLLREDVEYRTLTLNVLVQGAGVSEYQPLPTKVLDCDTITQVKEKLLDQVYKGTSFSH
RPHSDSLDLEWRSGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKQVPEGATVALVAERVS
TEHPLHTHTHTHTHTHTHTHTHTHTPSLSHYLSLLQTPMLEDADEGGVRPWHLVKASEEP
ELPKHRRGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVILSTCRPVPLAVKYFF
DLLDEQAGQHGISDSDTIHIWKTNSLPLRFWINIIKNPQFIFDVQASDHVDAVLSVISQT
FMDSCTIAEHKLGRDSPINKLLYARDIPRYKQMVERYYSDIRQTVSASDQEMNSALAELS
RNYSGELNYLVALHELYKYINKYYDQIITALEEDSTAQKMQLGYRLQQIAAAVENKV
Download sequence
Identical sequences H2S8Z1
ENSTRUP00000008867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]