SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008870 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008870
Domain Number 1 Region: 7-452
Classification Level Classification E-value
Superfamily Sema domain 2.75e-118
Family Sema domain 0.0000656
Further Details:      
 
Domain Number 2 Region: 1361-1488,1673-1859
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 821-917
Classification Level Classification E-value
Superfamily E set domains 1.87e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 914-1005
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000242
Family Other IPT/TIG domains 0.044
Further Details:      
 
Domain Number 5 Region: 455-506
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000222
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1004-1048,1088-1142
Classification Level Classification E-value
Superfamily E set domains 0.00000014
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.081
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008870
Domain Number - Region: 1153-1211
Classification Level Classification E-value
Superfamily E set domains 0.000824
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 
Domain Number - Region: 613-648
Classification Level Classification E-value
Superfamily Plexin repeat 0.00602
Family Plexin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008870   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008921
Sequence length 1892
Comment pep:known_by_projection scaffold:FUGU4:scaffold_301:104110:127319:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLSLYPTFVQNNTQFEHLALHPDPSIGWIYVGAQDHLFQLDRFLQPEYQTDTGPIIDSRE
CLPPVTESNCPQARITNNHNKLLLVDPYSMELITCGSVNQGICQKRSLDSVNNVFFSTER
PVDTQYVAANHPNVSTVGLVVRPKPDRKPLMFVGRGYTSSHPPISTRNLAQEPVFSYEET
AKLAVAGRLSEYDHHFVSSFAHRQHVYFFFYRRDLKSMSREYRTYVSRICLDDQAYYSYV
EVPLTCRSMAGKVYNLLQAAQLGISKDGVVDSETLFGVFSTHSTSSFPPSEDSALCMFNL
EDVDRRIISTRDLCYTQMGREAGVEVAYIEYEVKSNCANLPENTLETYPCGSDHTPSPMA
SRVPVEAETILNSPSARLTAVAVSVRAAHTIAFLGDSRGNLHKVFLGPNGEVEEYSVISV
QKNAAISSDLILDQNEEHLFIMTPNMLQKRPVAECQQHPDCQSCLLAHDPYCGWCVLDGR
CVLQSQCSRGQRPGEWLWSFDMDQQCLQVQELNPSNLSREESQTVSLTYSISGCAWAPLL
DEGESYSCIFEDVHSPAVVSRDRVSCQSPNPGSLPVVPLGQDYITVSLSLRFGSVTITVR
DFTFYDCTAVKQLSGRTPCRGCVRSRWGCNWCVQQHVCTHKPTCEDGTIIYNQHLMASSR
WGSSACPCLEKVQGSSLLPVGVERKITLLAQTYTCIRYNTQDVELDYECVLVIEGHTVVV
DAFVESDDMNPSSFDITCQLHKYQYSSVGNQYNAMVYVKRRNTFHLDSSPDLFVTLYNCS
VGRSDCSRCHTADQKYGCVWCGGAQASCLYSQSCSEPVQHTCPAPVIHSIEPLSGLLEGG
TMVTISGSNLGQKVEDILHSVSVAGVPCSVISSLYEISSRIVCRTTASGGKNSGQVSVKV
SGGELGLSTEMFTFQDPFVMSVSPHRGPKAGGTILTIIGRNLLTGRPSDLTVTVGRVSCH
IMEPYSSSSLQCVTGSSNLTGQYRVTLHYSSGLRHLHSSTYRYTHNPNITLAMPTKSFLR
GGRLIYVSGHNLDVVQEPRMVVTSSSSQLMQQRGKRMLPDHPECPENLQCFVREVSVCVC
GGGGGLWFSERCDVNSSSLMLCRSPSVDSSVMGSKMTVEFLLDNLRFNLSSLTPQGFTYE
PNPDLRPLNQQDPMKAYRYNPGSFIQLEGENLDLAITKDEVVVLIGQGVCAVKTLTRNHL
YCEPPPKQPPPISNGRNLPEFTVQMGNLNFSLGKVQYDTIGLSTFPLEAQIGVGVGASIV
ALIVPLQTFQIMRKSKQAMKDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVG
SGIPFLDYRMYAERIFFPGHRESPLRRDLDVQECRRQTVEQGLVQLSNLLNSKLFLTKFI
HTLESQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYAFLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLL
REDVEYRTLTLNVLVQGAGVSEYQPLPTKVLDCDTITQVKEKLLDQVYKGTSFSHRPHSD
SLDLEWRSGVAGHLILSDEDLTSVVQGSWKRLNTLQHYKQVPEGATVALVARHTKHIHDN
HDYMAGEKTPMLEDADEGGVRPWHLVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLL
SMKGTLQKFVDDLFTVILSTCRPVPLAVKYFFDLLDEQAGQHGISDSDTIHIWKTNSLPL
RFWINIIKNPQFIFDVQASDHVDAVLSVISQTFMDSCTIAEHKLGRDSPINKLLYARDIP
RYKQMVERYYSDIRQTVSASDQEMNSALAELSRNYSGELNYLVALHELYKYINKYYDQII
TALEEDSTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2S8Z4
ENSTRUP00000008870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]