SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008871 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008871
Domain Number 1 Region: 3-441
Classification Level Classification E-value
Superfamily Sema domain 5.49e-117
Family Sema domain 0.0000637
Further Details:      
 
Domain Number 2 Region: 1284-1411,1608-1794
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-48
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 886-977
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000229
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 4 Region: 790-884
Classification Level Classification E-value
Superfamily E set domains 0.000000000000056
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 5 Region: 444-495
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000279
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 976-1075
Classification Level Classification E-value
Superfamily E set domains 0.00000000018
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000008871
Domain Number - Region: 1086-1148
Classification Level Classification E-value
Superfamily E set domains 0.000406
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008871   Gene: ENSTRUG00000003774   Transcript: ENSTRUT00000008922
Sequence length 1824
Comment pep:known_by_projection scaffold:FUGU4:scaffold_301:104122:127307:1 gene:ENSTRUG00000003774 transcript:ENSTRUT00000008922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YPTFVQNNTQFEHLALHPDPSIGWIYVGAQDHLFQLDRFLQPEYQTDTGPIIDSRECLPP
VTESNCPQARITNNHNKLLLVDPYSMELITCGSVNQGICQKRSLDSVNNVFFSTERPVDT
QYVAANHPNVSTVGLVVRPKPDRKPLMFVGRGYTSSHPPISTRNLAQEPVFSYEETAKLA
VAGRLSEYDHHFVSSFAHRQHVYFFFYRRDLKSMSREYRTYVSRICLDDQAYYSYVEVPL
TCRSMAGKVYNLLQAAQLGISKDGVVDSETLFGVFSTHSTSSFPPSEDSALCMFNLEDVD
RRIISTRDLCYTQMGREAGVEVAYIECDSGENTLETYPCGSDHTPSPMASRVPVEAETIL
NSPSARLTAVAVSVRAAHTIAFLGDSRGNLHKVFLGPNGEVEEYSVISVQKNAAISSDLI
LDQNEEHLFIMTPNMLQKRPVAECQQHPDCQSCLLAHDPYCGWCVLDGRCVLQSQCSRGQ
RPGEWLWSFDMDQQCLQVQELNPSNLSREESQTVSISGCAWAPLLDEGESYSCIFEDVHS
PAVVSRDRVSCQSPNPGSLPVVPLGQGEQLLDSLSVSHHDISVTITVRDFTFYDCTVHSC
RGCVRSRWGCNWCVQQHVCTHKPTCEDGTIIYNQHVTCPCLEKVQGSSLLPVGVERKITL
LAQTYTCIRCPQDVELDYECVLVIEGHTVVVDAFVESDDMNPSSFDITCQLHKYSSVGNQ
YNAMVYVKRRNTFHLDSSPDLFVTLYNCSVGRSDCSRCHTADQKYGCVWCGGAQASCLYS
QSCSEPVQHTCPAPVIHSIEPLSGLLEGGTMVTISGSNLGQKVEDILHSVSVAGVPCSVI
SSLYEISSRIVCRTTASGGKNSGQVCLCILDCRMSLMFQSSSFVFCKDPFVMSVSPHRGP
KAGGTILTIIGRNLLTGRPSDLTVTVGRVSCHIMEPYSSSSLQCVTGSSNLTGQYRVTLH
YSSGLRHLHSSTYRYTHNPNITLAMPTKSFLRGGRLIYVSGHNLDVVQEPRITLSILNIY
FSERCDVNSSSLMLCRSPSVDSSVMGSKMTVEFLLDNLRFNLSSLTPQGFTYEPNPDLRP
LNQQDPMKAYRYNPGSFIQLEGENLDLAITKDEVVVLIGQGVCAVKTLTRNHLYCEPPPK
QPPPISNVQMGNLNFSLGKVQYDTIGLSTFPLEAQIGVGVGASIVALIVLLPLNRRKSKQ
AMKDYKKVQIQLENLETSVRDRCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFF
PGHRESPLRRDLDVQECRRQTVEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYV
ASLLTVALHGKLEYFTDILKTLLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYA
FLRDSAGESLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLVIERFLSE
YQPLPTKVLDCDTITQVKEKLLDQVYKGTSFSHRPHSDSLDLEWRSGVAGHLILSDEDLT
SVVQGSWKRLNTLQHYKQVPEGATVALVARHTKHIHDNHDYMAGRALSTFTQPFAMPFFW
RSQTPMLEDADEGGVRPWHLVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLLSMKGT
LQKFVDDLFTVILSTCRPVPLAVKYFFDLLDEQAGQHGISDSDTIHIWKTNSLPLRFWIN
IIKNPQFIFDVQASDHVDAVLSVISQTFMDSCTIAEHKLGRDSPINKLLYARDIPRYKQM
VERYYSDIRQTVSASDQEMNSALAELSRNYSGELNYLVALHELYKYINKYYDQIITALEE
DSTAQKMQLGYRLQQIAAAVENKV
Download sequence
Identical sequences H2S8Z5
ENSTRUP00000008871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]