SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009399 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009399
Domain Number 1 Region: 396-565
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-53
Family SPRY domain 0.00043
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.46e-18
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 107-169
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000009399
Domain Number - Region: 173-245
Classification Level Classification E-value
Superfamily BAG domain 0.062
Family BAG domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009399   Gene: ENSTRUG00000003968   Transcript: ENSTRUT00000009454
Sequence length 573
Comment pep:known_by_projection scaffold:FUGU4:scaffold_331:39634:43053:-1 gene:ENSTRUG00000003968 transcript:ENSTRUT00000009454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADHTSPDYFSCTLCLSLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNANAAQDSVYAGASDVPCDFCMDELGNLDRKICPQH
QKSLELFCRTDQMCICAICTVSEHRGHDIVSAEAERSEKQKLLGVSQAEIRQKCQERVKE
LEELKTAVDSLKNSAQRAMVESQKMFEDMIRSIDRMRSEVTKLIGINEKAAFNQAEALIE
RLEQEIDELKKKESGLKQLYGTDDHIHFLQVPKETAGSGRSAIVLVSRLTTRSSSPSELQ
LPLHPHRRRLHTPREPEPRLLLRCRQESRGRDQGAPGGVRPGGAAQDLQVRCDSSDGGSP
ILIQLLCTKKTNRTLCAGVAKEVTTDGVSSEPKSRADFLKYFCQLKLDPNTAYKELYISE
NSRKVIRTRDLQPYGDTSDRFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYRSISRK
GKGSMCLLGYNDKSWSLLCSDTGYSAWHNRVDKSISAPHSPRIGVYLDHSAGVLAFYSIS
GSMTLLHRFETTFVEPLYPGFGVGTSVKICNLK
Download sequence
Identical sequences H2SAH3
ENSTRUP00000009399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]