SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009474 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009474
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily Virus ectodomain 8.34e-17
Family Virus ectodomain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009474   Gene: ENSTRUG00000003995   Transcript: ENSTRUT00000009529
Sequence length 128
Comment pep:novel scaffold:FUGU4:scaffold_10472:250:633:-1 gene:ENSTRUG00000003995 transcript:ENSTRUT00000009529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVQNRMALDMLLAEKGGVCAMFGDQCCTFIPNNTAPDGSVTRALEGLRTLSDEMKEHSG
VTNPLEKWMDRMFGKWKVIIVSVLMSLISATAGLILCGCCCIPCIRSLCNRIIVTAIEGK
QPPPYQMA
Download sequence
Identical sequences H2SAP7
ENSTRUP00000009474 ENSTRUP00000009474 31033.ENSTRUP00000009474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]