SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009498 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009498
Domain Number 1 Region: 12-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 2 Region: 200-312
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 6.02e-19
Family Platelet-derived growth factor-like 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000009498
Domain Number - Region: 101-158
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 0.0851
Family NagB-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009498   Gene: ENSTRUG00000004007   Transcript: ENSTRUT00000009553
Sequence length 318
Comment pep:known_by_projection scaffold:FUGU4:scaffold_172:127372:138900:1 gene:ENSTRUG00000004007 transcript:ENSTRUT00000009553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQKEDNITVTAAGGVIHSPRYPNAYPRNLLLSWKLLSPPGTRIHLEFDGQFGLEEADNG
VCRYDFVEVEDLSETSTIIWGRWCGQKAPPSLNSKANMLRVTFNSDDYFVEKPGFKIYFS
MLMKQFAQAINDDGGQMYFPDTEVPLSLEELDRTIAAFESVEQLFRYLNPNTWKHDLDSI
YTQKHLHYRSMAYHLAGRYTKVDLNRHYDDVKQYSCTPRNYSVNLREELRTTNAIFFPRC
LLVQRCGGNCGCGTDNWNNGCNCRAAKTTLKLHEVLKYTPETNLYQRHQRTPVRWVIAEI
FLTHHDRCECECASQPPR
Download sequence
Identical sequences H2SAS1
ENSTRUP00000009498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]