SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009816 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009816
Domain Number 1 Region: 223-258
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000129
Family Plexin repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000009816
Domain Number - Region: 98-156
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0921
Family alpha-D-mannose-specific plant lectins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009816   Gene: ENSTRUG00000004152   Transcript: ENSTRUT00000009872
Sequence length 281
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2071:23820:30871:-1 gene:ENSTRUG00000004152 transcript:ENSTRUT00000009872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHVVEDSQRYYRWQSFGPTDHRTDELWVDLSSLHRSQVQIHNILSNTHRKAARVALSFD
FPFYGHYLRQIIIATGGFIFMGEITHQMLTATQYVAPLMANFDPSFSKNSTVKYLDNGNL
FVVQWDNVHLKDREDEGSFTFQAVLHSNGTIVFNYKDVPVQLAGINSTEHPVKVGLSDAF
MALLSPQPSAKDVKQQTIYEYHRVEINTTRIVGGSAFEFTPLPTCLQHTSCEPCMSSNLT
TGCGWCSTLQRCVTDRDSNEYEKINCLDKEITHISCKNRRG
Download sequence
Identical sequences H2SBN7
ENSTRUP00000009816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]