SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009817 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009817
Domain Number 1 Region: 223-263
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000907
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009817   Gene: ENSTRUG00000004152   Transcript: ENSTRUT00000009873
Sequence length 427
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2071:26414:30871:-1 gene:ENSTRUG00000004152 transcript:ENSTRUT00000009873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHVVEDSQRYYRWQSFGPTDHRTDELWVDLSSLHRSQVQIHNILSNTHRKAARVALSFD
FPFYGHYLRQIIIATGGFIFMGEITHQMLTATQYVAPLMANFDPSFSKNSTVKYLDNGNL
FVVQWDNVHLKDREDEGSFTFQAVLHSNGTIVFNYKDVPVQLAGINSTEHPVKVGLSDAF
MALLSPQPSAKDVKQQTIYEYHRVEINTTRIVGGSAFEFTPLPTCLQHTSCEPCMSSNLT
TGCGWCSTLQRCSDGIDRHRQEWLDYNCAEEAKATCEDYNPDGSTSSYYHTPLSPTPPSS
TLDDLSITNDSAHLKNSPEVESTFTSLSMFLIYRSTDSSSGRQRDTENTAIIAGVVAALV
LLVALTLLAVYYINTHPTVAPPFDLMQRRTNNYWPSMRFRNQGCQSSYAEVELGGHEKEG
FIEAEQC
Download sequence
Identical sequences H2SBN8
ENSTRUP00000009817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]