SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000009818 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000009818
Domain Number 1 Region: 235-275
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000924
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000009818   Gene: ENSTRUG00000004152   Transcript: ENSTRUT00000009874
Sequence length 428
Comment pep:known_by_projection scaffold:FUGU4:scaffold_2071:26414:30871:-1 gene:ENSTRUG00000004152 transcript:ENSTRUT00000009874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRELDLGSATDNMTHVVEDSQRYYRWQSFGPTDHRTDELWVDLSSLHRSQVQIHNILSNT
HRKAARVALSFDFPFYGHYLRQIIIATGGFIFMGEITHQMLTATQYVAPLMANFDPSFSK
NSTVKYLDNGNLFVVQWDNVHLKDREDEGSFTFQAVLHSNGTIVFNYKDVPVQLAGINST
EHPVKVGLSDAFMALLSPQPSAKDVKQQTIYEYHRVEINTTRIVGGSAFEFTPLPTCLQH
TSCEPCMSSNLTTGCGWCSTLQRCSDGIDRHRQEWLDYNCAEEAKATCEDYNPDGSTSSY
YHTPLSPTPPSSTLDDLSITNGRNDKTSQYNKYTDLQTAAPDDNGITENTAIIAGVVAAL
VLLVALTLLAVYYINTHPTVAPPFDLMQRRTNNYWPSMRFRNQGCQSSYAEVELGGHEKE
GFIEAEQC
Download sequence
Identical sequences H2SBN9
ENSTRUP00000009818 31033.ENSTRUP00000009818 ENSTRUP00000009818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]