SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010817 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010817
Domain Number 1 Region: 142-384
Classification Level Classification E-value
Superfamily vWA-like 4.61e-84
Family Integrin A (or I) domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 358-473
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-22
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 642-731
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-19
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 30-88
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000476
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 599-641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 558-596
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000010817
Domain Number - Region: 480-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0173
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010817   Gene: ENSTRUG00000004551   Transcript: ENSTRUT00000010875
Sequence length 803
Comment pep:known_by_projection scaffold:FUGU4:scaffold_319:245659:254775:1 gene:ENSTRUG00000004551 transcript:ENSTRUT00000010875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCVTSLANVFTDYGLLCCDIWNSYAQKEGNECIIASAKHCGECIQAGAKCGWCKDPAFLK
QGEAVSTRCDELQSLVKRGCNVDMIESPKGEKKILRNKPVTNRKKGGEKLQPHEITQIQP
QKLNLTLRSGEPQTFDLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMQKMSKI
TSDFQIGFGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYRNVLNLTSDGKQFNTLV
GQQQISGNLDSPEGGFDAIMQVAVCGNLIGWRDVTRLLVFSTDAGFHFAGDGKLGGIVLP
NDGKCHLEDNVYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSA
VGTLSANSSNVINLIIDAYNSLSSEVILENSKLPSGVTITYTSRCKNGVVNGGENGRKCS
NISIGDEVTFSISVTSKGCPNEGMSDTIKIKPLGFTEELEITLNFICGCDCQKVGINKSP
LCHSNGTYECGDCRCEDGHVGRECECSSNDVATEDMDRTCRKDNTTDICSNSGDCVCGTC
ECKNRDNPEERYSGQFCECDNFSCDRSGNKLCGGHGRCECRVCVCDLMWAGSACDCSLDN
TTCMASNKQICNGRGTCDCGICKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRTFGTGE
KKDTCEKDCSYFTLIKVKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNNTVKEV
HVVDSLDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKW
DTGENPIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2SEI6
ENSTRUP00000010817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]