SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010818 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010818
Domain Number 1 Region: 135-377
Classification Level Classification E-value
Superfamily vWA-like 4.56e-84
Family Integrin A (or I) domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 351-466
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-22
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 637-726
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-19
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 23-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000471
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 594-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 551-591
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000010818
Domain Number - Region: 473-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010818   Gene: ENSTRUG00000004551   Transcript: ENSTRUT00000010876
Sequence length 798
Comment pep:known_by_projection scaffold:FUGU4:scaffold_319:246213:254775:1 gene:ENSTRUG00000004551 transcript:ENSTRUT00000010876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFPQSPESFLRSRHLIFCNSEGNECIIASAKHCGECIQAGAKCGWCKDPAFLKQGEAVST
RCDELQSLVKRGCNVDMIESPKGEKKILRNKPVTNRKKGGEKLQPHEITQIQPQKLNLTL
RSGEPQTFDLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMQKMSKITSDFQIG
FGSFVEKTVMPYISTTPAKLLNPCTGDQNCTSPFSYRNVLNLTSDGKQFNTLVGQQQISG
NLDSPEGGFDAIMQVAVCGNLIGWRDVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHL
EDNVYTMSHYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTLSAN
SSNVINLIIDAYNSLSSEVILENSKLPSGVTITYTSRCKNGVVNGGENGRKCSNISIGDE
VTFSISVTSKGCPNEGMSDTIKIKPLGFTEELEITLNFICGCDCQKVGINKSPLCHSNGT
YECGDCRCEDGHVGRECECSSNDVATEDMDRTCRKDNTTDICSNSGDCVCGTCECKNRDN
PEERYSGQFCECDNFSCDRSGNKLCGGEWHGRCECRVCVCDLMWAGSACDCSLDNTTCMA
SNKQICNGRGTCDCGICKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRTFGTGEKKDTC
EKDCSYFTLIKVKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNNTVKEVHVVDS
LDCPAGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
Download sequence
Identical sequences H2SEI7
ENSTRUP00000010818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]