SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010820 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010820
Domain Number 1 Region: 127-369
Classification Level Classification E-value
Superfamily vWA-like 3e-84
Family Integrin A (or I) domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 343-458
Classification Level Classification E-value
Superfamily Integrin domains 3.61e-22
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 629-718
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-19
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 28-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000471
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 5 Region: 586-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 543-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000148
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000010820
Domain Number - Region: 465-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010820   Gene: ENSTRUG00000004551   Transcript: ENSTRUT00000010878
Sequence length 790
Comment pep:known_by_projection scaffold:FUGU4:scaffold_319:247049:254775:1 gene:ENSTRUG00000004551 transcript:ENSTRUT00000010878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLHSRPVLVIMDRLQVMNLNLTSVLKGNECIIASAKHCGECIQAGAKCGWCKDPAFLKQG
EAVSTRCDELQSLVKRGCNVDMIESPKGKKGGEKLQPHEITQIQPQKLNLTLRSGEPQTF
DLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMQKMSKITSDFQIGFGSFVEKT
VMPYISTTPAKLLNPCTGDQNCTSPFSYRNVLNLTSDGKQFNTLVGQQQISGNLDSPEGG
FDAIMQVAVCGNLIGWRDVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLEDNVYTMS
HYYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTLSANSSNVINLI
IDAYNSLSSEVILENSKLPSGVTITYTSRCKNGVVNGGENGRKCSNISIGDEVTFSISVT
SKGCPNEGMSDTIKIKPLGFTEELEITLNFICGCDCQKVGINKSPLCHSNGTYECGDCRC
EDGHVGRECECSSNDVATEDMDRTCRKDNTTDICSNSGDCVCGTCECKNRDNPEERYSGQ
FCECDNFSCDRSGNKLCGGEWHGRCECRVCVCDLMWAGSACDCSLDNTTCMASNKQICNG
RGTCDCGICKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRTFGTGEKKDTCEKDCSYFT
LIKVKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNNTVKEVHVVDSLDCPAGPD
IIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVT
TVVNPKYEGK
Download sequence
Identical sequences H2SEI9
ENSTRUP00000010820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]