SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010825 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010825
Domain Number 1 Region: 126-368
Classification Level Classification E-value
Superfamily vWA-like 4.56e-84
Family Integrin A (or I) domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 342-457
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-22
Family Integrin domains 0.00076
Further Details:      
 
Domain Number 3 Region: 626-715
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-19
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 4 Region: 15-72
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000392
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 583-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Integrin beta EGF-like domains 0.0029
Further Details:      
 
Domain Number 6 Region: 542-580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000010825
Domain Number - Region: 464-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.017
Family Integrin beta EGF-like domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010825   Gene: ENSTRUG00000004551   Transcript: ENSTRUT00000010883
Sequence length 798
Comment pep:known_by_projection scaffold:FUGU4:scaffold_319:248053:254856:1 gene:ENSTRUG00000004551 transcript:ENSTRUT00000010883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGNFPICIFFLLKGNECIIASAKHCGECIQAGAKCGWCKDPVWKQGEAVSTRCDELQSLV
KRGCNVDMIESPKGEKKILRNKPVTNRKKGGEKLQPHEITQIQPQKLNLTLRSGEPQTFD
LKFKRAEDYPIDLYYLMDLSYSMKDDLENVKNLGTSLMQKMSKITSDFQIGFGSFVEKTV
MPYISTTPAKLLNPCTGDQNCTSPFSYRNVLNLTSDGKQFNTLVGQQQISGNLDSPEGGF
DAIMQVAVCGNLIGWRDVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGKCHLEDNVYTMSH
YYDYPSIAHLVQKLSDNNIQTIFAVTEEFQPVYQELKNLIPKSAVGTLSANSSNVINLII
DAYNSLSSEVILENSKLPSGVTITYTSRCKNGVVNGGENGRKCSNISIGDEVTFSISVTS
KGCPNEGMSDTIKIKPLGFTEELEITLNFICGCDCQKVGINKSPLCHSNGTYECGDCRCE
DGHVGRECECSSNDVATEDMDRTCRKDNTTDICSNSGDCVCGTCECKNRDNPEERYSGQF
CECDNFSCDRSGNKLCGGHGRCECRVCVCDLMWAGSACDCSLDNTTCMASNKQICNGRGT
CDCGICKCTDPKFQGPTCEICPTCPGVCTEHKECVQCRTFGTGEKKDTCEKDCSYFTLIK
VKDRDKLPQPNDAAYPVMHCKERDANDCWFYYTYAVNNNTVKEVHVVDSLDCPAGPDIIP
IVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVV
NPKYEEYSPPALDFKRNR
Download sequence
Identical sequences H2SEJ4
ENSTRUP00000010825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]