SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011546 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011546
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000153
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 143-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000089
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 3-51
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000122
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011546   Gene: ENSTRUG00000004832   Transcript: ENSTRUT00000011606
Sequence length 252
Comment pep:known_by_projection scaffold:FUGU4:scaffold_256:107053:108631:-1 gene:ENSTRUG00000004832 transcript:ENSTRUT00000011606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGYEGKVNISMDTGSLELRNLTVNDSGQYMVIILPKQQSTQIGTTTLNVYVPVSGVVVSN
PDGDLVESSSSVRLSCSSSGSSLSFLWLNSSSEVTASDRVHTTDGGSTLVISNVTRYDQG
PFRCHVFNPVSNGTSDPVDLTINYGPENIKIAGPDQIQVGQSLTMTCSTESKPLASYKWT
LNETALSNSSEFSFVVQRSSDGGNYSCHAVNSVTGRTLSAVHAVSVAQKPISVSCVVLVG
AAIGGLNQLNLC
Download sequence
Identical sequences H2SGL4
ENSTRUP00000011546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]