SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011857 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011857
Domain Number 1 Region: 1-448
Classification Level Classification E-value
Superfamily Sema domain 7.98e-151
Family Sema domain 0.00000000535
Further Details:      
 
Domain Number 2 Region: 451-489
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000068
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 505-587
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000183
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011857   Gene: ENSTRUG00000004957   Transcript: ENSTRUT00000011917
Sequence length 788
Comment pep:known_by_projection scaffold:FUGU4:scaffold_134:64321:72516:-1 gene:ENSTRUG00000004957 transcript:ENSTRUT00000011917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYSALLLEEESGLLYVGSRGALYALNTSNISTATGLRIDWDASPEQKKLCLNKGRDNQTE
CYNHIRFLQRYNESHLYTCGTNAFRPLCAYVDAERFSLLSGIEEGRDRCPYDPAKGYTGL
LVDKDGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTRWLLEADFVGSVLLKESFNSSV
GDDDKIYFFFTERSQEQIAYPSQTKVSRIARVCKNDWGGQRTLQRKWTSFLKARMVCTVP
EYELHLNILRSVFVLQGRDARSSIFYGIFGLEWKNIKASAICQYAFSDVQKVFEGPYMEV
QDSKWREYTGKVPEPRPGSCITDLHRSQSINTSRDLPDNVLTFARRHPLMAGQVHPVGLR
PLMFKRSVNYVRIAVHKEPALDGNLYTVLFLGTDDGWLHRAVDVQGEMHIIEELQLFDKP
QPVEGLVISSALRSIYISAASGLVQLPMSACQRYTSCYDCVFARDPFCGWDGKVCVEVAS
RAQRSNLTQDVLRGIRGCRENSGNAPFSHALRKRSVMAGDDVLLQCELRSNLASPRWTLN
GRELMGYGLNSGYRIGTDGLLIIGARAQQSGSYRCFAVENSVSVLVYLYSVRVHTDVPSE
QPLPSPPAPLPPQFQTYRHMEAVYISLVAILGGLCLVLTVVLLYVSFCTRRAVQDRKRSS
HFELKTIASHCNGRQDRRSTSVPTFGDLGDGFLQIVPGEGQLSPAKTPPPAPPLPMPPPL
PNMDYANGLSATLPSVLRKMNGNSYVLLRQADSEGMSPLYHSFTEELNRILEKRKHTQLS
LQPDESSI
Download sequence
Identical sequences H2SHH5
ENSTRUP00000011857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]