SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011858 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011858
Domain Number 1 Region: 2-391
Classification Level Classification E-value
Superfamily Sema domain 1.7e-134
Family Sema domain 0.0000000216
Further Details:      
 
Domain Number 2 Region: 394-425
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 451-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000196
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011858   Gene: ENSTRUG00000004957   Transcript: ENSTRUT00000011918
Sequence length 721
Comment pep:known_by_projection scaffold:FUGU4:scaffold_134:64321:71844:-1 gene:ENSTRUG00000004957 transcript:ENSTRUT00000011918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTECYNHIRFLQRYNESHLYTCGTNAFRPLCAYVDAERFSLLSGIEEGRDRCPYDPAKGY
TGLLVDKDGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTRWLLEADFVGSVLLKESFN
SSVGDDDKIYFFFTERSQEQIAYPSQTKVSRIARVCKNDWGGQRTLQRKWTSFLKARMVC
TVPEYELHLNILRSVFVLQGRDARSSIFYGIFGLEWKNIKASAICQYAFSDVQKVFEGPY
MEVQDSKWREYTGKVPEPRPGSCITDLHRSQSINTSRDLPDNVLTFARRHPLMAGQVHPV
GLRPLMFKRSVNYVRIAVHKEPALDGNLYTVLFLGTDDGWLHRAVDVQGEMHIIEELQLF
DKPQPVEGLVISSALRSIYISAASGLVQLPMSACQRYTSCYDCVFARDPFCGWDGKVCVE
VASRAQSMFLLYSAAGLTPNLCYASVIHRKRSVMAGDDVLLQCELRSNLASPRWTLNGRE
LMGYGLNSGYRIGTDGLLIIGARAQQSGSYRCFAVENSVSVLVYLYSVRVHTDPYFPVEP
TAATEPHMEAVYISLVAILGGLCLVLTVVLLYDRKFSQQGLQVLGASDRKRSSHFELKTI
ASHCNGRQDRRSTSVPTFGDLGDGFLQIVPGEGQLSPAKTPPPAPPLPMPPPLPNMDYAN
GLSATLPSVLRKMNGNSYVLLRQADSEGMSPLYHSFTEELNRILEKRKHTQLSLQPDESS
I
Download sequence
Identical sequences H2SHH6
ENSTRUP00000011858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]