SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011859 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011859
Domain Number 1 Region: 1-444
Classification Level Classification E-value
Superfamily Sema domain 5.62e-150
Family Sema domain 0.0000000067
Further Details:      
 
Domain Number 2 Region: 447-474
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000157
Family Plexin repeat 0.0029
Further Details:      
 
Domain Number 3 Region: 509-598
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000014
Family I set domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011859   Gene: ENSTRUG00000004957   Transcript: ENSTRUT00000011919
Sequence length 600
Comment pep:known_by_projection scaffold:FUGU4:scaffold_134:64993:72504:-1 gene:ENSTRUG00000004957 transcript:ENSTRUT00000011919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLEEESGLLYVGSRGALYALNTSNISTATGLRIDWDASPEQKKLCLNKGRDNQTECYNH
IRFLQRYNESHLYTCGTNAFRPLCAYVDAERFSLLSGIEEGRDRCPYDPAKGYTGLLVDK
DGEMFTATQYEFRSSPDVRRNFPFPTLRTEEAPTRWLLEADFVGSVLLKESFNSSVGDDD
KIYFFFTERSQEQIAYPSQTKVSRIARVCKNDWGGQRTLQRKWTSFLKARMVCTVPEYEL
HLNILRSVFVLQGRDARSSIFYGIFGLEWKNIKASAICQYAFSDVQKVFEGPYMEVQDSK
WREYTGKVPEPRPGSCITDLHRSQSINTSRDLPDNVLTFARRHPLMAGQVHPVGLRPLMF
KRSVNYVRIAVHKEPALDGNLYTVLFLGTDDGWLHRAVDVQGEMHIIEELQLFDKPQPVE
GLVISSALRSIYISAASGLVQLPMSACQRYTSCYDCVFARDPFCGWDGKLTFTARRKYQS
LIIINTRKMKTSFSLVSMKTAIKGFHRKRSVMAGDDVLLQCELRSNLASPRWTLNGRELM
GYGLNSGYRIGTDGLLIIGARAQQSGSYRCFAVENSVSVLVYLYSVRVHTDPYFPVEPTA
Download sequence
Identical sequences H2SHH7
ENSTRUP00000011859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]