SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012590 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012590
Domain Number 1 Region: 262-352
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.09e-25
Family SWIB/MDM2 domain 0.0000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012590   Gene: ENSTRUG00000005247   Transcript: ENSTRUT00000012651
Sequence length 492
Comment pep:known_by_projection scaffold:FUGU4:scaffold_81:22704:27990:1 gene:ENSTRUG00000005247 transcript:ENSTRUT00000012651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRGGFTGPPMNSNVHPMNVGHAAGMRMPGMPQPPMGFPRRMPPNRAGGPMASMGGQMP
GPSYGGGNMAMRPGMGPPGMDPSRKRFLHQHPQQQQQEALGGLRRGAKRRKMADKVLPQR
IRDLVPESQAYMDLLAFERKLDQTISRKRMEIQEAIKKPIMQKRKLRIYISNTYTPSKPE
GEDSEKVASWELRVEGKLLEEPGKQKKKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTT
QETDGFQVKRPGDVNVKCTLLFMLDHQPPQYKLDPRLARLLGVHTQTRASIMQALWLYIK
NNKLQDCHEKEYINCNRYFRQIFGCGRMRFAEIPMKLAGLLQHPDPIIINHTISSVDPAD
QKKTACYDIDVEVDDPLKSQMNNFLSSTTNQQEIAALEMKIHETIEYINQLKTERDFMLS
FSNNPQDFIQDWLKSQSRDLKLMTDVTGNPEEERRTEFYQAPWVPEAVSRYVFSKVQQRR
QELEQVLGIRLT
Download sequence
Identical sequences H2SJK7
ENSTRUP00000012590 31033.ENSTRUP00000012590 ENSTRUP00000012590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]