SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013224 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013224
Domain Number 1 Region: 22-193
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.96e-45
Family G proteins 0.0000277
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013224   Gene: ENSTRUG00000005501   Transcript: ENSTRUT00000013285
Sequence length 201
Comment pep:known_by_projection scaffold:FUGU4:scaffold_235:318844:319446:-1 gene:ENSTRUG00000005501 transcript:ENSTRUT00000013285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNHLTDMAPSAPSFLPGFHSLHVVVIGLDSAGKTSLLYRLKLKEFVKTIPTKGFNTEKV
RVPVGTSRSICFQVWDVGGQEKLRPLWKSYTRRTDGMVFVVDSTELERMEEARVELHKIT
RTSENQGVPVLILANKQDSDSALSVSEVEKLLSVHELSMYTLHHVQGCSAVDGRGLQPGL
EKLHEMILKRKKMMKHSRNRR
Download sequence
Identical sequences H2SLD8
ENSTRUP00000013224 31033.ENSTRUP00000013224 ENSTRUP00000013224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]