SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000013643 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000013643
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-23
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000785
Family LIM domain 0.0015
Further Details:      
 
Domain Number 3 Region: 250-282
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000103
Family LIM domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000013643   Gene: ENSTRUG00000005644   Transcript: ENSTRUT00000013706
Sequence length 328
Comment pep:known_by_projection scaffold:FUGU4:scaffold_40:243320:247272:1 gene:ENSTRUG00000005644 transcript:ENSTRUT00000013706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVNVVLDGPAPWGFRMIGGKDFNQALTISRVTPGSKASMANLCAGDVILAIEGVPTKDM
LHCDAQNKIKESTHRLSLTIERNESRLWTPHVVDQGRAHPFKINLEAERQEYKPIGAAHN
RKAQPFVAAANIDDKRQVVSATYNTPIGLYSSDNIQDAMEGQIRGLVTNRPERFHPFGEF
LVSRPSSRTLTSIEDSDVYRMLQKDEEEPHAPRQSGSFKALQDFIDSDGTRPIGTRTVKA
PTIKQAPPTGNLQKLPICDKCGNGIVGTVVKARDKFRHPGCFVCSHCDVNLKQQGYFFVE
GQLYCEAHARARMRPPEGHDLVTTFPSA
Download sequence
Identical sequences H2SMK7
ENSTRUP00000013643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]