SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000014159 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000014159
Domain Number 1 Region: 99-342
Classification Level Classification E-value
Superfamily vWA-like 2.78e-68
Family Integrin A (or I) domain 0.00000187
Further Details:      
 
Domain Number 2 Region: 1111-1295
Classification Level Classification E-value
Superfamily Fibronectin type III 5.19e-39
Family Fibronectin type III 0.0000286
Further Details:      
 
Domain Number 3 Region: 1493-1694
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-33
Family Fibronectin type III 0.0009
Further Details:      
 
Domain Number 4 Region: 600-683
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.92e-18
Family Integrin beta tail domain 0.0031
Further Details:      
 
Domain Number 5 Region: 970-1088
Classification Level Classification E-value
Superfamily CalX-like 2.09e-16
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 6 Region: 1-49
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000371
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 7 Region: 514-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000014159
Domain Number - Region: 556-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00153
Family Integrin beta EGF-like domains 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000014159   Gene: ENSTRUG00000005807   Transcript: ENSTRUT00000014224
Sequence length 1789
Comment pep:known_by_projection scaffold:FUGU4:scaffold_254:213188:229216:1 gene:ENSTRUG00000005807 transcript:ENSTRUT00000014224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYCFSSRAKSCSECLQAGKGCAYCSEETFNGPRCDLQENILAHGCSAAAMITAQSSRNVE
KGEQINMQLLKSQVSPQLMSMSFLPGEEKMVDVEVFAPTKGPLDLYILMDFSNSMSDDLD
NLKRMGKELASLVEQLSDDYTIGFGKFVDKVIEPQTDMRPAKLAKPWANSDPPFSFQNVI
NLTSNLEFFNTKLKNETISGNLDAPEGGFDAILQAAVCGDRIGWRSNSTHLLVFSTESAF
HYETDGANVLSGIVKRNDEGCHLDPAGKYTQDIYQDYPSIPTLVRLLGKHNIIPIFAVTN
HSYTYYQKLKEYFPIAEVGLLQEDSSNILQVMETAFESIRSKMSIRAEDRPKAFEAQFFS
SSKKLSKYGDFDFKPGEIGKFKMRLKAQRMIDDGPVCQTEQDEREGTIRVKPTTFNDAVN
VKASLLCPTCECEKTVVQNAPRCHGQGDLVCGKCQCHDGWLSTFCNCSASASALVTGQCI
GPGMTEPCSGRGDCMECGTCVCYNPEQFEGPYCEYDKTQCQRYGGFLCNDRGSCVMGKCT
CTEGWEGNACECPKSNQTCLDSKGGVCNDRGKCLCGRCACPSSGIEMTSTCEPNFQAQLG
ACEATRSCVQCQAWKTGEKKDKKDCDACPFTVVMVDELKKSDQVLDSCSFRDEDDDCTYH
YTVENPKDKDLEVQVLKKKDCPPASLLWLLPLLLFLLLLLALLLLCCWKYCACCKTCWQS
CLALLPCCRRGRMVGWKEDEYLFRQSLLTSDHLDTPMVRTGPPKGTDVVRWRVTDNVHRG
PNHPQAIVKPNPKEMIPFPLSLRLDKLFFDNLARPESKDAEQLRSEVADNLNELYKQIPS
AQKVQKTAFRMQRNAGKRQDYTIVDTVLSAPRSSFPDIVKLTEKNVQSGRMHNLKVVPGY
YTVETDREAMGAIEFQEGVESLDVHVPLFVKEEDDDKKKLQLEAVDVPLGIADIAKRFVN
ITIIKDHASSIFSFLQPAYTYSRQDGLVNIPVSREIIEDGRTQVTYRTRDLTAKDKLDYV
TVEGDLNYGPGETQKTVPVRLLELGEKDGLMEDKQIKQFVMDLSNPRVGAKLGRYPRTTI
TIADEPGPEISQKQQKGYISPKASLPGGFLSAPSNPKAKATGPRSIHLNWDPPPGNPMGY
KVKYWIYGDPEKDAQVLDVKSPRADLTNLYPFCDYEMRVCAYNTKGDGYETDIVTCQTLE
DVPGEPGRLAFNVISPTVTQLSWAEPAETNGNITAYEVIYTPIDDELSPVGPPKKVQIDN
PKKRMLLIENLQNAQTYQYKVRAKNSVGWGPFRDASINLASQPNRPLSIPIIPDIPIVDA
EAGDEYDSYLMYSNEVLKSPTGSKTPSVSGDVRTTSEVDGELLFQGPISLFSLHPTAWLR
LVLGCLTSSALHGSNRNDSTLNSTSSSPMSTLSSNYRGAGGSFNTETTTTYLSGPVFPPV
SALSSSLLLLNAPSGGFSYSRMQSSPQSPHSYSLLQGSRERTQSSDDARLSPGVPDTPSR
LVFSALGPTALKVSWQEPHCERDILGYCIIYQLLNGGEVKRINVTNPAENSVIIQDLLPN
HSYLFKVKAQSQEGWGPEREGVITIESAVDPRSPLSPMPGSPFTLSTPSAPGPLVFTALS
PDSLQLSWEKPRKPNGDILGYVVTCEQLHGGGDVRTFQVNGDSTEMSLTVPDLVENVPYK
FKVQARTTQGFGPEREGIITIESQDGSALSQYNNQSMVRRDVFHMPTEVSTRTNVSHTVV
NDPFFSEGMMMTTQHMETSGTVTRQVTKEVVQRSVMGGTTITKKMFYET
Download sequence
Identical sequences H2SP22
ENSTRUP00000014159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]