SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016002 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016002
Domain Number 1 Region: 36-513
Classification Level Classification E-value
Superfamily Sema domain 1.31e-159
Family Sema domain 0.00000000343
Further Details:      
 
Domain Number 2 Region: 515-568
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000101
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016002   Gene: ENSTRUG00000006523   Transcript: ENSTRUT00000016073
Sequence length 837
Comment pep:known_by_projection scaffold:FUGU4:scaffold_217:204279:212421:1 gene:ENSTRUG00000006523 transcript:ENSTRUT00000016073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNRPRIDVILLQVFLIVCLLCLCCTSARKVKTHTFYPLNAKERTAKRFSASGVVNFTT
LHLSNEDKTLYVGAREILFALNLTDISEVTLHRNFTWETPDRKREECSFKGKDLQKDCFN
YIKIFLRVNSTHLYVCGTYAFSPTCAYIKTDNFSLVKSDSGEVVTEDGRSRCPFNPEYKS
TAIIADGELYAGTVSNFQGNEPIIYKSLSQGTSLKTENSLNWLQDPAFVGSAYIQESLPK
GNEVGDDDKIYFFFSEVGKEFDFFDNTLVSRIARVCKGDLGGERVLQKKWTTFLKAQLLC
SLPDDGFPFNIIQDMFVLTPSPEDWKNTVFYGVFTSQWYKGASGSSAVCSFTMDQVAKAF
NGRYREVNRETQQWYTYNHPVPEPRPGMCITNDARKQDIPSSLRMPDKVLNFVKDHFLMD
SVIRSSPLLLKRNAHYTQIAVHRVQTGSKVYHVLFVGTDDGRLHKAININGKMHIIEEMV
LFRNSQPVLNIELDTEKGRLYISSFSELVEVPIANCTNYQSCGECVLSRDPYCAWDGSQC
VDIRQTPPNKHFRAWQQSIVEADTATICNKVLNPRFAKSPSIRTSACQPITIPANTFRVL
PCKLRSNLAVRKWEFRKTPGHFHYPSPEGGLVVVGQADRQENYECWSVEEGFRQLLANYC
VRGEARQESTTFTGRSHIPPISQEEFIILPGEARSPHMNTKTYWNELLVVCALLAFSLVV
FSLFVVYRNRSHMKSMLKEGECPAIQQKKPRTVGKPVENLPLNGNAVTASVSDHKGYQAL
NDNYICSTPPCSSPDNSKSFSESEKRPLNLKESHVEISPTCPRPRVRLGSMIKDSIV
Download sequence
Identical sequences H2SUB5
ENSTRUP00000016002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]