SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016003 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016003
Domain Number 1 Region: 2-467
Classification Level Classification E-value
Superfamily Sema domain 1.96e-158
Family Sema domain 0.00000000353
Further Details:      
 
Domain Number 2 Region: 469-508
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000275
Family Plexin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016003   Gene: ENSTRUG00000006523   Transcript: ENSTRUT00000016074
Sequence length 664
Comment pep:known_by_projection scaffold:FUGU4:scaffold_217:205454:212097:1 gene:ENSTRUG00000006523 transcript:ENSTRUT00000016074 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRFSASGVVNFTTLHLSNEDKTLYVGAREILFALNLTDISEVTLHRNFTWETPDRKREEC
SFKGKDLQKDCFNYIKIFLRVNSTHLYVCGTYAFSPTCAYIKTDNFSLVKSDSGEVVTED
GRSRCPFNPEYKSTAIIADGELYAGTVSNFQGNEPIIYKSLSQGTSLKTENSLNWLQDPA
FVGSAYIQESLPKGNEVGDDDKIYFFFSEVGKEFDFFDNTLVSRIARVCKGDLGGERVLQ
KKWTTFLKAQLLCSLPDDGFPFNIIQDMFVLTPSPEDWKNTVFYGVFTSQWWYKGASGSS
AVCSFTMDQVAKAFNGRYREVNRETQQWYTYNHPVPEPRPGMCITNDARKQDIPSSLRMP
DKVLNFVKDHFLMDSVIRSSPLLLKRNAHYTQIAVHRVQTGSKVYHVLFVGTDDGRLHKA
ININGKMHIIEEMVLFRNSQPVLNIELDTEKGRLYISSFSELVEVPIANCTNYQSCGECV
LSRDPYCAWDGSQCVDIRQTPPNNLVSHIFEADTATICNKVLNPRFAKSPSIRTSACQPI
TIPANTFRVLPCKLRSNLAVRKWEFRKTPGHFHYPSPEGGLVVVGQADRQENYECWSVEE
GFRQLLANYCVRGEARQEEFIILPGEARSPHMNTKTYWNELLVVCALLAFSLVVFSLFVV
YRNR
Download sequence
Identical sequences H2SUB6
ENSTRUP00000016003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]