SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016133 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016133
Domain Number 1 Region: 30-522
Classification Level Classification E-value
Superfamily Sema domain 4.84e-168
Family Sema domain 0.0000000000801
Further Details:      
 
Domain Number 2 Region: 518-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000314
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 585-665
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000126
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016133   Gene: ENSTRUG00000006572   Transcript: ENSTRUT00000016205
Sequence length 680
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:143031:170260:1 gene:ENSTRUG00000006572 transcript:ENSTRUT00000016205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEATAPLFTCSVCVWGGYKFERSPPLIRVSSLSLTDLLSTNRSSIFSGHHGQLALTSVYL
DEYRDRLFLGGKDVLYSLLLGPTSSESKEIYWPPLPGSREHCIETGKEPQTECANFVRLL
QPHNRTHLLACGTGAFQPMCAFISVGHRGEQHVFTMDPTNVENGRGKVPHDPSLPFASTF
SGGELYTGLTADFLGRDSVIFRSMGSRSTMRTETDQKLLHDPKFVAAHLVPDNVDRDNDK
VYFFFTEKATEAGDREGAIHTRVGRVCANDVGGQRVLVNKWSTFIKARLVCSVPGPHGID
THFNQLEDVFLLRTKDERNPDVYALFSTISNVFQGFAVCVYRMADIREAFNGPFAHKEGP
DYRWGAYEGRVPYPRPGVCPSKITNQPGREFGSTKDFPDSVLQFARNHPLMWRPVYPALR
RPVLVKANTPYKLRQIVVDRVEAEDGQYDVMFIGTDVGTVLKVIALHGGNSLDAEEVTLE
ELQVFKVPTPITSMDISVKRQSLYVGSPAGVALVKLHRCETYGNACAECCLARDPYCAWD
GAVCARYLANSKRRFRRQDIRHGNPVLQCSDQNLSEDLDMTEDRMVYVTENNSTFLECIP
RSPQATVTWFVQRDDRKEEVKLDDRILSTDQGLLFRRVLHQDEGSYICRSREHGFTQTLA
RLNLQVLQGETVDDLLTRDI
Download sequence
Identical sequences H2SUP6
ENSTRUP00000016133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]