SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016138 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016138
Domain Number 1 Region: 6-498
Classification Level Classification E-value
Superfamily Sema domain 5.49e-168
Family Sema domain 0.0000000000757
Further Details:      
 
Domain Number 2 Region: 494-545
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000549
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 562-642
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000115
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016138   Gene: ENSTRUG00000006572   Transcript: ENSTRUT00000016210
Sequence length 763
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:145431:170578:1 gene:ENSTRUG00000006572 transcript:ENSTRUT00000016210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLIRVSSLSLTDLLSTNRSSIFSGHHGQLALTSVYLDEYRDRLFLGGKDVLYSLLLGPTS
SESKEIYWPPLPGSREHCIETGKEPQTECANFVRLLQPHNRTHLLACGTGAFQPMCAFIS
VGHRGEDHVFTMDPTNVENGRGKVPHDPSLPFASTFSGGELYTGLTADFLGRDSVIFRSM
GSRSTMRTETDQKLLHDPKFVAAHLVPDNVDRDNDKVYFFFTEKATEAGDREGAIHTRVG
RVCANDVGGQRVLVNKWSTFIKARLVCSVPGPHGIDTHFNQLEDVFLLRTKDERNPDVYA
LFSTISNVFQGFAVCVYRMADIREAFNGPFAHKEGPDYRWGAYEGRVPYPRPGVCPSKIT
NQPGREFGSTKDFPDSVLQFARNHPLMWRPVYPALRRPVLVKANTPYKLRQIVVDRVEAE
DGQYDVMFIGTDVGTVLKVIALHGGNSLDAEEVTLEELQVFKVPTPITSMDISVKRQSLY
VGSPAGVALVKLHRCETYGNACAECCLARDPYCAWDGAVCARYLANSKRRFRRQDIRHGN
PVLQCSDQNLSAEDLDMTEDRMVYVTENNSTFLECIPRSPQATVTWFVQRDDRKEEVKLD
DRILSTDQGLLFRRVLHQDEGSYICRSREHGFTQTLARLNLQVLQGETVDDLLTRDIGGL
SDPFKDRSTGGYRAWMPCSAYSRAGSLGTIGQSRTWFKDIMQLIGPSNLPHVEEYCERMW
CNDKLRRKHKSMVEKYRQAQDSARKVRKSPGERNRTPRDVSLW
Download sequence
Identical sequences H2SUQ1
ENSTRUP00000016138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]