SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016140 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016140
Domain Number 1 Region: 2-491
Classification Level Classification E-value
Superfamily Sema domain 1.31e-167
Family Sema domain 0.0000000000786
Further Details:      
 
Domain Number 2 Region: 487-538
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000523
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 560-640
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000134
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016140   Gene: ENSTRUG00000006572   Transcript: ENSTRUT00000016212
Sequence length 735
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:145452:170569:1 gene:ENSTRUG00000006572 transcript:ENSTRUT00000016212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLTDLLSTNRSSIFSGHHGQLALTSVYLDEYRDRLFLGGKDVLYSLLLGPTSSESKEIY
WPPLPGSREHCIETGKEPQTECANFVRLLQPHNRTHLLACGTGAFQPMCAFISVGHRGED
HVFTMDPTNVENGRGKVPHDPSLPFASTFSGGELYTGLTADFLGRDSVIFRSMGSRSTMR
TETDQKLLHDPKFVAAHLVPDNVDRDNDKVYFFFTEKATEAGDREGAIHTRVGRVCANDV
GGQRVLVNKWSTFIKARLVCSVPGPHGIDTHFNQLEDVFLLRTKDERNPDVYALFSTISN
VFQGFAVCVYRMADIREAFNGPFAHKEGPDYRWGAYEGRVPYPRPGVCPSKITNQPGREF
GSTKDFPDSVLQFARNHPLMWRPVYPALRRPVLVKANTPYKLRQIVVDRVEAEDGQYDVM
FIGTDVGTVLKVIALHGGNSLDAEEVTLEELQVFKVPTPITSMDISVKRQSLYVGSPAGV
ALVKLHRCETYGNACAECCLARDPYCAWDGAVCARYLANSKRRFRRQDIRHGNPVLQCSD
QNYHSSNHYSEDLDMTEDRMVYVTENNSTFLECIPRSPQATVTWFVQRDDRKEEVKLDDR
ILSTDQGLLFRRVLHQDEGSYICRSREHGFTQTLARLNLQVLQGETVDDLLTRDIGGLSD
PFKDRSTSRTWFKDIMQLIGPSNLPHVEEYCERMWCNDKLRRKHKSMVEKYRQAQDSARK
VRKSPGERNRTPRDV
Download sequence
Identical sequences H2SUQ3
ENSTRUP00000016140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]