SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016141 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016141
Domain Number 1 Region: 3-467
Classification Level Classification E-value
Superfamily Sema domain 1.44e-163
Family Sema domain 0.000000000113
Further Details:      
 
Domain Number 2 Region: 463-514
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000279
Family Plexin repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 530-617
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000348
Family V set domains (antibody variable domain-like) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016141   Gene: ENSTRUG00000006572   Transcript: ENSTRUT00000016213
Sequence length 618
Comment pep:known_by_projection scaffold:FUGU4:scaffold_54:145521:170218:1 gene:ENSTRUG00000006572 transcript:ENSTRUT00000016213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTSVYLDEYRDRLFLGGKDVLYSLLLGPTSSESKEIYWPPLPGSREHCIETGKEPQTECA
NFVRLLQPHNRTHLLACGTGAFQPMCAFISVGHRGEHVFTMDPTNVENGRGKVPHDPSLP
FASTFSGGELYTGLTADFLGRDSVIFRSMGSRSTMRTETDQKLLHDPKFVAAHLVPDNVD
RDNDKVYFFFTEKATEAGDREGAIHTRVGRVCANDVGGQRVLVNKWSTFIKARLVCSVPG
PHGIDTHFNQLEDVFLLRTKDERNPDVYALFSTISNVFQGFAVCVYRMADIREAFNGPFA
HKEGPDYRWGAYEGRVPYPRPGVCPSKITNQPGREFGSTKDFPDSVLQFARNHPLMWRPV
YPALRRPVLVKANTPYKLRQIVVDRVEAEDGQYDVMFIGTDVGTVLKVIALHGGNSLDAE
EVTLEELQVFKVPTPITSMDISVKRQSLYVGSPAGVALVKLHRCETYGNACAECCLARDP
YCAWDGAVCARYLANSKRRFRRQDIRHGNPVLQCSDQNLSEDLDMTEDRMVYVTENNSTF
LECIPRSPQATVTWFVQRDDRKEEQIPTQKKVKLDDRILSTDQGLLFRRVLHQDEGSYIC
RSREHGFTQTLARLNLQV
Download sequence
Identical sequences H2SUQ4
ENSTRUP00000016141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]