SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016428 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016428
Domain Number 1 Region: 30-495
Classification Level Classification E-value
Superfamily Sema domain 4.45e-153
Family Sema domain 0.00000000229
Further Details:      
 
Domain Number 2 Region: 497-546
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000706
Family Plexin repeat 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000016428
Domain Number - Region: 552-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00408
Family V set domains (antibody variable domain-like) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016428   Gene: ENSTRUG00000006689   Transcript: ENSTRUT00000016500
Sequence length 590
Comment pep:known_by_projection scaffold:FUGU4:scaffold_200:108125:112205:1 gene:ENSTRUG00000006689 transcript:ENSTRUT00000016500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMCSCLLPLAWTLKDDSSLEYTPRRSVAFHSESSSRFHGGVANYTTMLLREDLDVLLVGA
REAIYALDLKDISKNRASVKWEVTQQQISECRNKGKHPEMDCKNFIKILHKRDDNKMYVC
GTNAFEPKCDYMSYADGQLTLERKVEDGKGKCPFDPFQRHTSLMLENNLYSATSMNFLGT
EAVLMRSSPVTIRTEFKSSWLNEPTFVSMTQIPESQMSAVGDDDKVYLFFSEVAVECDCH
NKLLVSRVARVCKGDIGGERTLQKKWTSFLKARMDCPVLESQLPYVIQDVYHWCGSHRGW
RDCLFYAVFRPQSETSDLSAVCAYRVSDVSNVFAEGKYKTPVTVETSFVKWVMYSGDVPV
PRPGACIDNEARNNGINDTLHLPDPTLQFIKLRPLMDQTIQPVGGKPLLVHKGAAFTRIV
VNQVQAADGEKYHVMFMGTEEGTLVKGVNYDGEMFLIEEVQVFQPRVSIKILKFSNVTGQ
LYAGSDSGVTQVPLATCGRSTSCMDCVLSRDPYCGWDMVDGKCSLLSSSTRLELIQSVKE
GDAKLCPPAEQTSFKFLTNRTIWPGGNLKLYCHSPSQLAETVWVKDGHTL
Download sequence
Identical sequences H2SVJ0
ENSTRUP00000016428 31033.ENSTRUP00000016428 ENSTRUP00000016428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]