SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000016547 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000016547
Domain Number 1 Region: 1-250
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.77e-23
Family FCH domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000016547   Gene: ENSTRUG00000006731   Transcript: ENSTRUT00000016619
Sequence length 253
Comment pep:known_by_projection scaffold:FUGU4:scaffold_359:145639:147933:1 gene:ENSTRUG00000006731 transcript:ENSTRUT00000016619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLGEAWTQLKKSLHDEAEVHLKFSNKLHSEVEKPLLTFRGDNFKKDLKKYDHHIADLRKQ
LASRYAGVEKARKALADRQKDLEVKTQQLEIKLSNKHEEDIKKARRKSTQAGDDLMRCVD
LYNQTQSKWFEEMVTTCMVTRHQNPPVHVALLSRLFVLPLQELEKLEVERIEWIQTHLRQ
YTTLRHETDMFNQSVSPSVPSQIRVFLLPEVLLCSQVVEPVDQLLQKVDPGKDRELWVKE
NKTGEVRPVDMDI
Download sequence
Identical sequences H2SVV9
ENSTRUP00000016547 31033.ENSTRUP00000016547 ENSTRUP00000016547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]