SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000017387 from Takifugu rubripes 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000017387
Domain Number 1 Region: 898-1026,1197-1383
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-45
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 2 Region: 482-574
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000097
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 3 Region: 53-105
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000353
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 4 Region: 395-485
Classification Level Classification E-value
Superfamily E set domains 0.00000000156
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 5 Region: 573-620
Classification Level Classification E-value
Superfamily E set domains 0.00000175
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Domain Number 6 Region: 9-55
Classification Level Classification E-value
Superfamily Sema domain 0.0000235
Family Sema domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000017387
Domain Number - Region: 208-242
Classification Level Classification E-value
Superfamily Plexin repeat 0.0222
Family Plexin repeat 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000017387   Gene: ENSTRUG00000007076   Transcript: ENSTRUT00000017461
Sequence length 1416
Comment pep:known_by_projection scaffold:FUGU4:scaffold_215:188976:199718:1 gene:ENSTRUG00000007076 transcript:ENSTRUT00000017461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLVEPDLSGHLYGSLLVDSGSSINADLLLDQSQQHIYVLTNSRLSKVPVSSCERQTDCQ
SCLAVRDPYCGWCVLEGRCSRKQQCQRHSQPNQWFWSFEATSQCVNVQNLQPASQSRAEQ
NQVTLSVVQLPVLTEAESLSCVFGLLPPQPAVVTGTSITCQSPVPELLPPMPTGSDHMIL
PVSLVFGHVTIATSNMTFYDCGAVSRLNQSSQCLACVTSVWRCNWCPLDQLCTHNHSCPN
QHVILSQRESPGPTSCPLVFGLQSSALVPLGMTTSLVLRGRNLDVYTVRLISVLVNGSAG
LKLLQDSLEQKGLPFQFALSQLQYSVPIYLCRGERRIDASPGLRLQLYDCSAGQSDCSQC
RAVPEEYGCVWCPGSPSPGCVYNQSCSRTPEDSWPTSSDVQPLSGPLEGGILVTISGSNL
GMRDVVGGITVAGVPCPPQAEGYHISTRVVCELQPSGKQREGPVMVRVGAAPPGESRQVF
TYQDPQILSLVPDKGPVSGGTQLTIRGQQLLTGQKSDLRAFLGVQSCYSLEEVNDTHLVC
QTASSNQTGGVVVRVLFGKAERTIGSMKFRYLDDPVITEASPAESFYAGGRVIMVTGRNL
DVVQQPILAVWVEPVEVQRQPDNREIHPPTTVHTKSFIFTDALISVSLSLSLGLSLPRSV
SHSVCLSLCLSVFQGQSFTYYPNPDFFRLNSHIKLYVTFLLFHGNPQGQDLTRAISRQEV
TARLGNEECEVKTLDNTHLYCEPPEVQPMSVDDGSELPSLKVFMGNLQVDLGLVQYDSDS
LLSPVPLAAQIGLAGGAAIIILSVLVVILMRKSKQALRDYKKVLVQLETLEINVGDQCRK
EFTDLMTEMMDLSSDVGGPGLPLLDYKTYAERVFFPGQHVAPLTRQLDLPESRRQTVEQG
LQQLNNLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTMALHDKLEYFTEVMKTLLQD
LVQQYVAKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEVAGEPLYMLYRAIKYQVDKGP
VDSVTGKAKRTLNDSHLLREDIDYSAMTLTVLVKNGVEVQPCPVKVLDIDTITQVKDKIL
DQVYRGAPFSQRPAADSLDLEWRSGQAGHLTLSDDDVTAVVHGRWKRLNTLQHYKVPDGA
TVALIPRSQSSETPMLEGEEEEGLRLWHLVKSSEDPDIPKHRKSSMRDRERAKAIPEIYL
TRLLSMKGTLQKFVDDVFVAILSTKRPPPIAVRFFFDFLDDMAEKHGIDDPETVHIWKTN
SLPLRFWVNILKNPQFVLDVQVTDSIDAVLSVIAQTFIDSCTTSEHKVGRDSPVNKLLYA
REIPRYKQLVERYYSDIHSAASGCYQEMNSTLTELSGSFASEMNNLVALHELYKYINKYY
DQIIMSLDEDSSGQKMQLAYRLQQVAALVENKVTDL
Download sequence
Identical sequences H2SY99
ENSTRUP00000017387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]